• Gene id: 940

Gene Summary

• Gene Symbol: CD28   Gene   UCSC   Ensembl
• Aliases: Tp44
• Gene name: CD28 molecule
• Alternate names: T-cell-specific surface glycoprotein CD28, CD28 antigen,
• Gene location: 2q33.2 (203706474: 203739755)     Exons: 4     NC_000002.12
• Gene summary(Entrez): The protein encoded by this gene is essential for T-cell proliferation and survival, cytokine production, and T-helper type-2 development. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene.[provide
• OMIM: 603253

Protein Summary

• Protein general information: P10747  
  • Name: T cell specific surface glycoprotein CD28 (TP44) (CD antigen CD28)
  • Length: 220  
  • Mass: 25066
  • Tissue specificity: Expressed in T-cells and plasma cells, but not in less mature B-cells.
• Sequence:

  MLRLLLALNLFPSIQVTGNKILVKQSPMLVAYDNAVNLSCKYSYNLFSREFRASLHKGLDSAVEVCVVYGNYSQQ
  LQVYSKTGFNCDGKLGNESVTFYLQNLYVNQTDIYFCKIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPS
  KPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS

• Structural information:
  • Protein Domains: (28..13-)
    (/note="Ig-like-V-type")
  • Interpro: IPR008093  IPR040216  IPR036179  IPR013783  IPR013106  
  • PDB: 1YJD 3WA4 5AUL 5GJH 5GJI 6O8D
  • PDBsum: 1YJD 3WA4 5AUL 5GJH 5GJI 6O8D
  • DIP: 6043
  • STRING: ENSP00000324890
• Other Databases: GeneCards:  CD28  Malacards:  CD28

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045086	positive regulation of interleukin-2 biosynthetic process	IBA	biological process
GO:0042110	T cell activation	IBA	biological process
GO:0031295	T cell costimulation	IBA	biological process
GO:0002376	immune system process	IBA	biological process
GO:0050852	T cell receptor signaling pathway	IBA	biological process
GO:0042102	positive regulation of T cell proliferation	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0032733	positive regulation of interleukin-10 production	IDA	biological process
GO:0032753	positive regulation of interleukin-4 production	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042129	regulation of T cell proliferation	IEA	biological process
GO:0006955	immune response	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0098636	protein complex involved in cell adhesion	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0050690	regulation of defense response to virus by virus	TAS	biological process
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0031295	T cell costimulation	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0051897	positive regulation of protein kinase B signaling	IEA	biological process
GO:0050852	T cell receptor signaling pathway	IEA	biological process
GO:0048304	positive regulation of isotype switching to IgG isotypes	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0045060	negative thymic T cell selection	IEA	biological process
GO:0042102	positive regulation of T cell proliferation	IEA	biological process
GO:0019901	protein kinase binding	IEA	molecular function
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0002863	positive regulation of inflammatory response to antigenic stimulus	IEA	biological process
GO:0097190	apoptotic signaling pathway	IEA	biological process
GO:0046641	positive regulation of alpha-beta T cell proliferation	IEA	biological process
GO:0045589	regulation of regulatory T cell differentiation	IEA	biological process
GO:0045086	positive regulation of interleukin-2 biosynthetic process	IEA	biological process
GO:0031295	T cell costimulation	IEA	biological process
GO:0014068	positive regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0001772	immunological synapse	IEA	cellular component
GO:0042110	T cell activation	IGI	biological process
GO:0002020	protease binding	IPI	molecular function
GO:0045066	regulatory T cell differentiation	IDA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0045086	positive regulation of interleukin-2 biosynthetic process	IDA	biological process
GO:0045840	positive regulation of mitotic nuclear division	IDA	biological process
GO:0042102	positive regulation of T cell proliferation	IDA	biological process
GO:0043066	negative regulation of apoptotic process	TAS	biological process
GO:0045727	positive regulation of translation	NAS	biological process
GO:0006959	humoral immune response	TAS	biological process
GO:0042802	identical protein binding	NAS	molecular function
GO:0042102	positive regulation of T cell proliferation	TAS	biological process
GO:0007166	cell surface receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0010629	negative regulation of gene expression	IMP	biological process
GO:0045070	positive regulation of viral genome replication	NAS	biological process
GO:0010628	positive regulation of gene expression	IMP	biological process
GO:0042089	cytokine biosynthetic process	TAS	biological process
GO:0015026	coreceptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04514	Cell adhesion molecules
hsa05322	Systemic lupus erythematosus
hsa05162	Measles
hsa04660	T cell receptor signaling pathway
hsa05235	PD-L1 expression and PD-1 checkpoint pathway in cancer
hsa05323	Rheumatoid arthritis
hsa05416	Viral myocarditis
hsa04672	Intestinal immune network for IgA production
hsa05320	Autoimmune thyroid disease
hsa04940	Type I diabetes mellitus
hsa05332	Graft-versus-host disease
hsa05330	Allograft rejection

Diseases

Associated diseases	References
Diabetic angiopathy	PMID:15504310
leukemia	PMID:19075187
Multiple sclerosis	PMID:14975605
Asthma	PMID:21356099
Interstitial lung disease	PMID:20030671
Chronic obstructive pulmonary disease	PMID:19220836
Pulmonary hypertension	PMID:19075187
Rheumatoid arthritis	PMID:19075187
Chronic fatigue syndrome	PMID:18801465
type 1 diabetes mellitus	PMID:15504310
type 1 diabetes mellitus	PMID:11685455
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R