• Gene id: 93978

Gene Summary

• Gene Symbol: CLEC6A   Gene   UCSC   Ensembl
• Aliases: CLEC4N, CLECSF10, dectin-2
• Gene name: C-type lectin domain containing 6A
• Alternate names: C-type lectin domain family 6 member A, C-type (calcium dependent, carbohydrate-recognition domain) lectin, superfamily member 10, C-type lectin superfamily member 10, DC-associated C-type lectin 2, dectin 2, dendritic cell-associated C-type lectin 2,
• Gene location: 12p13.31 (8455961: 8478329)     Exons: 6     NC_000012.12
• Gene summary(Entrez): The protein encoded by this gene is a type II membrane receptor with an extracellular C-type lectin-like domain fold. The extracellular portion binds structures with a high mannose content and has been shown to recognize several pathogens, including C. el
• OMIM: 613579

Protein Summary

• Protein general information: Q6EIG7  
  • Name: C type lectin domain family 6 member A (C type lectin superfamily member 10) (Dendritic cell associated C type lectin 2) (DC associated C type lectin 2) (Dectin 2)
  • Length: 209  
  • Mass: 23998
  • Tissue specificity: Expressed in lung, spleen, lymph node, leukocytes, bone marrow, tonsils and dendritic cells. Strongly expressed in purified monocytes and weakly in B-cells. In peripheral blood cells, preferentially expressed in plasmacytoids rather th
• Sequence:

  MMQEQQPQSTEKRGWLSLRLWSVAGISIALLSACFIVSCVVTYHFTYGETGKRLSELHSYHSSLTCFSEGTKVPA
  WGCCPASWKSFGSSCYFISSEEKVWSKSEQNCVEMGAHLVVFNTEAEQNFIVQQLNESFSYFLGLSDPQGNNNWQ
  WIDKTPYEKNVRFWHLGEPNHSAEQCASIVFWKPTGWGWNDVICETRRNSICEMNKIYL

• Structural information:
  • Protein Domains: (86..20-)
    (/note="C-type-lectin)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00040"-)
  • Interpro: IPR001304  IPR016186  IPR033989  IPR016187  
  • Prosite: PS50041
  • CDD: cd03590
  • PDB: 5VYB
  • PDBsum: 5VYB
  • STRING: ENSP00000371505
• Other Databases: GeneCards:  CLEC6A  Malacards:  CLEC6A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005509	calcium ion binding	IDA	molecular function
GO:0030246	carbohydrate binding	IDA	molecular function
GO:0005537	mannose binding	IDA	molecular function
GO:0050832	defense response to fungus	ISS	biological process
GO:0050715	positive regulation of cytokine secretion	ISS	biological process
GO:0045087	innate immune response	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0030246	carbohydrate binding	ISS	molecular function
GO:0002376	immune system process	IEA	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0045087	innate immune response	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0002223	stimulatory C-type lectin receptor signaling pathway	TAS	biological process
GO:0050832	defense response to fungus	IEA	biological process
GO:0050715	positive regulation of cytokine secretion	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0030246	carbohydrate binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04625	C-type lectin receptor signaling pathway

Diseases

Associated diseases	References
Obstructive azoospermia	MIK: 30389958

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
30389958	Obstructive azoospermia	c.23A?>?C (p.Gln8Pro)		4 (2 infertile brothers and 2 fertile family members)	Male infertility	NGS