• Gene id: 9397

Gene Summary

• Gene Symbol: NMT2   Gene   UCSC   Ensembl
• Gene name: N-myristoyltransferase 2
• Alternate names: glycylpeptide N-tetradecanoyltransferase 2, NMT 2, glycylpeptide N-tetradecanoyltransferase 2 variant 3, glycylpeptide N-tetradecanoyltransferase 2 variant 4, myristoyl-CoA:protein N-myristoyltransferase 2, peptide N-myristoyltransferase 2, type II N-myristoylt,
• Gene location: 10p13 (15168692: 15104587)     Exons: 16     NC_000010.11
• Gene summary(Entrez): This gene encodes one of two N-myristoyltransferase proteins. N-terminal myristoylation is a lipid modification that is involved in regulating the function and localization of signaling proteins. The encoded protein catalyzes the addition of a myristoyl g
• OMIM: 608785

Protein Summary

• Protein general information: O60551  
  • Name: Glycylpeptide N tetradecanoyltransferase 2 (EC 2.3.1.97) (Myristoyl CoA:protein N myristoyltransferase 2) (NMT 2) (Peptide N myristoyltransferase 2) (Type II N myristoyltransferase)
  • Length: 498  
  • Mass: 56980
• Sequence:

  MAEDSESAASQQSLELDDQDTCGIDGDNEEETEHAKGSPGGYLGAKKKKKKQKRKKEKPNSGGTKSDSASDSQEI
  KIQQPSKNPSVPMQKLQDIQRAMELLSACQGPARNIDEAAKHRYQFWDTQPVPKLDEVITSHGAIEPDKDNVRQE
  PYSLPQGFMWDTLDLSDAEVLKELYTLLNENYVEDDDNMFRFDYSPEFLLWALRPPGWLLQWHCGVRVSSNKKLV
  GFISAIPANIRIYDSVKKMVEINFLCVHKKLRSKRVAPVLIREITRRVNLEGIFQAVYTAGVVLPKPIATCRYWH
  RSLNPRKLVEVKFSHLSRNMTLQRTMKLYRLPDVTKTSGLRPMEPKDIKSVRELINTYLKQFHLAPVMDEEEVAH
  WFLPREHIIDTFVVESPNGKLTDFLSFYTLPSTVMHHPAHKSLKAAYSFYNIHTETPLLDLMSDALILAKSKGFD
  VFNALDLMENKTFLEKLKFGIGDGNLQYYLYNWRCPGTDSEKVGLVLQ

• Structural information:
  • Interpro: IPR016181  IPR000903  IPR022677  IPR022678  IPR022676  
  • Prosite: PS00975 PS00976
  • PDB: 4C2X
  • PDBsum: 4C2X
  • STRING: ENSP00000367407
• Other Databases: GeneCards:  NMT2  Malacards:  NMT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	IBA	molecular function
GO:0005737	cytoplasm	IBA	cellular component
GO:0018008	N-terminal peptidyl-glycine N-myristoylation	IBA	biological process
GO:0019898	extrinsic component of membrane	IDA	cellular component
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	IDA	molecular function
GO:0005737	cytoplasm	IDA	cellular component
GO:0018008	N-terminal peptidyl-glycine N-myristoylation	IDA	biological process
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	IEA	molecular function
GO:0006499	N-terminal protein myristoylation	IEA	biological process
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	IEA	molecular function
GO:0022400	regulation of rhodopsin mediated signaling pathway	TAS	biological process
GO:0004379	glycylpeptide N-tetradecanoyltransferase activity	TAS	molecular function
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0075733	intracellular transport of virus	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0043657	host cell	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray