• Gene id: 9390

Gene Summary

• Gene Symbol: SLC22A13   Gene   UCSC   Ensembl
• Aliases: OAT10, OCTL1, OCTL3, ORCTL-3, ORCTL3
• Gene name: solute carrier family 22 member 13
• Alternate names: solute carrier family 22 member 13, organic cationic transporter-like 3, organic-cation transporter like 3, solute carrier family 22 (organic anion transporter), member 13, solute carrier family 22 (organic anion/urate transporter), member 13,
• Gene location: 3p22.2 (38265811: 38278756)     Exons: 10     NC_000003.12
• Gene summary(Entrez): This gene encodes a member of the organic-cation transporter family. It is located in a gene cluster with another member of the family, organic cation transporter like 4. The encoded protein is a transmembrane protein involved in the transport of small mo
• OMIM: 604047

Protein Summary

• Protein general information: Q9Y226  
  • Name: Solute carrier family 22 member 13 (Organic cation transporter like 3) (ORCTL 3)
  • Length: 551  
  • Mass: 60862
  • Tissue specificity: Ubiquitous, expressed at low levels. {ECO
• Sequence:

  MAQFVQVLAEIGDFGRFQIQLLILLCVLNFLSPFYFFAHVFMVLDEPHHCAVAWVKNHTFNLSAAEQLVLSVPLD
  TAGHPEPCLMFRPPPANASLQDILSHRFNETQPCDMGWEYPENRLPSLKNEFNLVCDRKHLKDTTQSVFMAGLLV
  GTLMFGPLCDRIGRKATILAQLLLFTLIGLATAFVPSFELYMALRFAVATAVAGLSFSNVTLLTEWVGPSWRTQA
  VVLAQCNFSLGQMVLAGLAYGFRNWRLLQITGTAPGLLLFFYFWALPESARWLLTRGRMDEAIQLIQKAASVNRR
  KLSPELMNQLVPEKTGPSGNALDLFRHPQLRKVTLIIFCVWFVDSLGYYGLSLQVGDFGLDVYLTQLIFGAVEVP
  ARCSSIFMMQRFGRKWSQLGTLVLGGLMCIIIIFIPADLPVVVTMLAVVGKMATAAAFTISYVYSAELFPTILRQ
  TGMGLVGIFSRIGGILTPLVILLGEYHAALPMLIYGSLPIVAGLLCTLLPETHGQGLKDTLQDLELGPHPRSPKS
  VPSEKETEAKGRTSSPGVAFVSSTYF

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  
  • Prosite: PS50850
  • STRING: ENSP00000310241
• Other Databases: GeneCards:  SLC22A13  Malacards:  SLC22A13

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0090416	nicotinate transmembrane transporter activity	EXP	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0034356	NAD biosynthesis via nicotinamide riboside salvage pathway	TAS	biological process
GO:0016020	membrane	IEA	cellular component
GO:2001142	nicotinate transport	IDA	biological process
GO:0090416	nicotinate transmembrane transporter activity	IDA	molecular function
GO:0045922	negative regulation of fatty acid metabolic process	IDA	biological process
GO:0005783	endoplasmic reticulum	IDA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0002854	positive regulation of T cell mediated cytotoxicity directed against tumor cell target	IDA	biological process
GO:0016324	apical plasma membrane	IDA	cellular component
GO:0015747	urate transport	IDA	biological process
GO:0005886	plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)