• Gene id: 9388

Gene Summary

• Gene Symbol: LIPG   Gene   UCSC   Ensembl
• Aliases: EDL, EL, PRO719
• Gene name: lipase G, endothelial type
• Alternate names: endothelial lipase, endothelial cell-derived lipase, lipase, endothelial, lipoprotein lipase H,
• Gene location: 18q21.1 (132670400: 132592996)     Exons: 26     NC_000009.12
• Gene summary(Entrez): The protein encoded by this gene has substantial phospholipase activity and may be involved in lipoprotein metabolism and vascular biology. This protein is designated a member of the TG lipase family by its sequence and characteristic lid region which pro
• OMIM: 603684

Protein Summary

• Protein general information: Q9Y5X9  
  • Name: Endothelial lipase (EC 3.1.1.3) (Endothelial cell derived lipase) (EDL) (EL)
  • Length: 500  
  • Mass: 56795
  • Tissue specificity: High level of expression in the liver, placenta, lung, thyroid, kidney, testis and in the corpus luteum of the ovary. Expressed also in coronary artery endothelial cells, umbilical vein endothelial cells and in hepatocytes and osteosar
• Sequence:

  MSNSVPLLCFWSLCYCFAAGSPVPFGPEGRLEDKLHKPKATQTEVKPSVRFNLRTSKDPEHEGCYLSVGHSQPLE
  DCSFNMTAKTFFIIHGWTMSGIFENWLHKLVSALHTREKDANVVVVDWLPLAHQLYTDAVNNTRVVGHSIARMLD
  WLQEKDDFSLGNVHLIGYSLGAHVAGYAGNFVKGTVGRITGLDPAGPMFEGADIHKRLSPDDADFVDVLHTYTRS
  FGLSIGIQMPVGHIDIYPNGGDFQPGCGLNDVLGSIAYGTITEVVKCEHERAVHLFVDSLVNQDKPSFAFQCTDS
  NRFKKGICLSCRKNRCNSIGYNAKKMRNKRNSKMYLKTRAGMPFRVYHYQMKIHVFSYKNMGEIEPTFYVTLYGT
  NADSQTLPLEIVERIEQNATNTFLVYTEEDLGDLLKIQLTWEGASQSWYNLWKEFRSYLSQPRNPGRELNIRRIR
  VKSGETQRKLTFCTEDPENTSISPGRELWFRKCRDGWRMKNETSPTVELP

• Structural information:
  • Protein Domains: (347..48-)
    (/note="PLAT-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00152"-)
  • Interpro: IPR029058  IPR013818  IPR016272  IPR033906  IPR002330   IPR001024  IPR036392  IPR000734  
  • Prosite: PS00120 PS50095
  • CDD: cd00707
  • STRING: ENSP00000261292
• Other Databases: GeneCards:  LIPG  Malacards:  LIPG

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016298	lipase activity	IBA	molecular function
GO:0005615	extracellular space	IBA	cellular component
GO:0016042	lipid catabolic process	IBA	biological process
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0004806	triglyceride lipase activity	IDA	molecular function
GO:0004465	lipoprotein lipase activity	IEA	molecular function
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0006629	lipid metabolic process	IEA	biological process
GO:0052689	carboxylic ester hydrolase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0005576	extracellular region	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0016042	lipid catabolic process	IEA	biological process
GO:0006629	lipid metabolic process	IEA	biological process
GO:0008970	phospholipase A1 activity	TAS	molecular function
GO:0006629	lipid metabolic process	TAS	biological process
GO:0006629	lipid metabolic process	TAS	biological process
GO:0008970	phospholipase A1 activity	IEA	molecular function
GO:0052739	phosphatidylserine 1-acylhydrolase activity	IEA	molecular function
GO:0004806	triglyceride lipase activity	IEA	molecular function
GO:0052740	1-acyl-2-lysophosphatidylserine acylhydrolase activity	IEA	molecular function
GO:0008970	phospholipase A1 activity	IDA	molecular function
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0009986	cell surface	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0034375	high-density lipoprotein particle remodeling	TAS	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0007584	response to nutrient	IEA	biological process
GO:0004620	phospholipase activity	IEA	molecular function
GO:0050746	regulation of lipoprotein metabolic process	IEA	biological process
GO:0008283	cell population proliferation	IEA	biological process
GO:0004620	phospholipase activity	IDA	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0032376	positive regulation of cholesterol transport	IDA	biological process
GO:0009395	phospholipid catabolic process	NAS	biological process
GO:0010983	positive regulation of high-density lipoprotein particle clearance	IMP	biological process
GO:0034375	high-density lipoprotein particle remodeling	IMP	biological process
GO:0042632	cholesterol homeostasis	IMP	biological process
GO:0043691	reverse cholesterol transport	IMP	biological process
GO:0055091	phospholipid homeostasis	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00561	Glycerolipid metabolism
hsa04979	Cholesterol metabolism

Diseases

Associated diseases	References
cardiovascular system disease	PMID:16023652
Coronary artery disease	PMID:16354105
Cerebral infarction	PMID:17016617
Myocardial infarction	PMID:17526978
obesity	PMID:16772345
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray