• Gene id: 9380

Gene Summary

• Gene Symbol: GRHPR   Gene   UCSC   Ensembl
• Aliases: GLXR, GLYD, PH2
• Gene name: glyoxylate and hydroxypyruvate reductase
• Alternate names: glyoxylate reductase/hydroxypyruvate reductase, epididymis secretory sperm binding protein, glycerate-2-dehydrogenase, glyoxylate reductase and hydroxypyruvate reductase,
• Gene location: 9p13.2 (37422434: 37438951)     Exons: 12     NC_000009.12
• Gene summary(Entrez): This gene encodes an enzyme with hydroxypyruvate reductase, glyoxylate reductase, and D-glycerate dehydrogenase enzymatic activities. The enzyme has widespread tissue expression and has a role in metabolism. Type II hyperoxaluria is caused by mutations in
• OMIM: 604296

Protein Summary

• Protein general information: Q9UBQ7  
  • Name: Glyoxylate reductase/hydroxypyruvate reductase (EC 1.1.1.79) (EC 1.1.1.81)
  • Length: 328  
  • Mass: 35668
  • Tissue specificity: Ubiquitous. Most abundantly expressed in the liver. {ECO
• Sequence:

  MRPVRLMKVFVTRRIPAEGRVALARAADCEVEQWDSDEPIPAKELERGVAGAHGLLCLLSDHVDKRILDAAGANL
  KVISTMSVGIDHLALDEIKKRGIRVGYTPDVLTDTTAELAVSLLLTTCRRLPEAIEEVKNGGWTSWKPLWLCGYG
  LTQSTVGIIGLGRIGQAIARRLKPFGVQRFLYTGRQPRPEEAAEFQAEFVSTPELAAQSDFIVVACSLTPATEGL
  CNKDFFQKMKETAVFINISRGDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHR
  TRNTMSLLAANNLLAGLRGEPMPSELKL

• Structural information:
  • Interpro: IPR006139  IPR029753  IPR006140  IPR036291  
  • Prosite: PS00671
  • PDB: 2GCG 2H1S 2Q50 2WWR
  • PDBsum: 2GCG 2H1S 2Q50 2WWR
  • STRING: ENSP00000313432
• Other Databases: GeneCards:  GRHPR  Malacards:  GRHPR

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0030267	glyoxylate reductase (NADP) activity	IBA	molecular function
GO:0016618	hydroxypyruvate reductase activity	IBA	molecular function
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IBA	molecular function
GO:0008465	glycerate dehydrogenase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016616	oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor	IEA	molecular function
GO:0051287	NAD binding	IEA	molecular function
GO:0055114	oxidation-reduction process	IEA	biological process
GO:0016491	oxidoreductase activity	IEA	molecular function
GO:0030267	glyoxylate reductase (NADP) activity	IEA	molecular function
GO:0016618	hydroxypyruvate reductase activity	IEA	molecular function
GO:0005782	peroxisomal matrix	TAS	cellular component
GO:0030267	glyoxylate reductase (NADP) activity	TAS	molecular function
GO:0034641	cellular nitrogen compound metabolic process	TAS	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0016618	hydroxypyruvate reductase activity	IEA	molecular function
GO:0030267	glyoxylate reductase (NADP) activity	IEA	molecular function
GO:0051287	NAD binding	IEA	molecular function
GO:0005829	cytosol	IEA	cellular component
GO:0008465	glycerate dehydrogenase activity	IEA	molecular function
GO:0031406	carboxylic acid binding	IEA	molecular function
GO:0043648	dicarboxylic acid metabolic process	IEA	biological process
GO:0050661	NADP binding	IEA	molecular function
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0070402	NADPH binding	IDA	molecular function
GO:1902494	catalytic complex	IDA	cellular component
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0008465	glycerate dehydrogenase activity	IDA	molecular function
GO:0046487	glyoxylate metabolic process	IDA	biological process
GO:0030267	glyoxylate reductase (NADP) activity	IDA	molecular function
GO:0030267	glyoxylate reductase (NADP) activity	IDA	molecular function
GO:0016618	hydroxypyruvate reductase activity	IDA	molecular function
GO:0016618	hydroxypyruvate reductase activity	IDA	molecular function
GO:0016618	hydroxypyruvate reductase activity	IDA	molecular function
GO:0055114	oxidation-reduction process	IDA	biological process
GO:0051287	NAD binding	TAS	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component
GO:0007588	excretion	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa00620	Pyruvate metabolism
hsa00260	Glycine, serine and threonine metabolism
hsa00630	Glyoxylate and dicarboxylate metabolism

Diseases

Associated diseases	References
Primary hyperoxaluria	KEGG:H00117
Primary hyperoxaluria	KEGG:H00117
Primary hyperoxaluria	PMID:10484776
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881