• Gene id: 9377

Gene Summary

• Gene Symbol: COX5A   Gene   UCSC   Ensembl
• Aliases: COX, COX-VA, VA
• Gene name: cytochrome c oxidase subunit 5A
• Alternate names: cytochrome c oxidase subunit 5A, mitochondrial, cytochrome c oxidase polypeptide Va, cytochrome c oxidase polypeptide, mitochondrial, cytochrome c oxidase subunit Va, mitochondrial cytochrome c oxidase subunit Va,
• Gene location: 15q24.2 (74938072: 74919790)     Exons: 5     NC_000015.10
• Gene summary(Entrez): Cytochrome c oxidase (COX) is the terminal enzyme of the mitochondrial respiratory chain. It is a multi-subunit enzyme complex that couples the transfer of electrons from cytochrome c to molecular oxygen and contributes to a proton electrochemical gradien
• OMIM: 603773

Protein Summary

• Protein general information: P20674  
  • Name: Cytochrome c oxidase subunit 5A, mitochondrial (Cytochrome c oxidase polypeptide Va)
  • Length: 150  
  • Mass: 16762
• Sequence:

  MLGAALRRCAVAATTRADPRGLLHSARTPGPAVAIQSVRCYSHGSQETDEEFDARWVTYFNKPDIDAWELRKGIN
  TLVTYDMVPEPKIIDAALRACRRLNDFASTVRILEVVKDKAGPHKEIYPYVIQELRPTLNELGISTPEELGLDKV

• Structural information:
  • Interpro: IPR003204  IPR036545  
  • CDD: cd00923
  • PDB: 5Z62
  • PDBsum: 5Z62
  • STRING: ENSP00000317780
• Other Databases: GeneCards:  COX5A  Malacards:  COX5A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005751	mitochondrial respiratory chain complex IV	IBA	cellular component
GO:0004129	cytochrome-c oxidase activity	IBA	molecular function
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	IBA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0004129	cytochrome-c oxidase activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005739	mitochondrion	IEA	cellular component
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004129	cytochrome-c oxidase activity	TAS	molecular function
GO:0005743	mitochondrial inner membrane	TAS	cellular component
GO:0006123	mitochondrial electron transport, cytochrome c to oxygen	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005751	mitochondrial respiratory chain complex IV	IEA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0004129	cytochrome-c oxidase activity	IEA	molecular function
GO:0005743	mitochondrial inner membrane	IEA	cellular component
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:1902600	proton transmembrane transport	IEA	biological process
GO:0006119	oxidative phosphorylation	IEA	biological process
GO:0005751	mitochondrial respiratory chain complex IV	IMP	cellular component
GO:0005743	mitochondrial inner membrane	IDA	cellular component
GO:0005751	mitochondrial respiratory chain complex IV	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0009055	electron transfer activity	TAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa01100	Metabolic pathways
hsa05010	Alzheimer disease
hsa05016	Huntington disease
hsa05012	Parkinson disease
hsa04714	Thermogenesis
hsa00190	Oxidative phosphorylation
hsa04932	Non-alcoholic fatty liver disease
hsa04260	Cardiac muscle contraction

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)