• Gene id: 9376

Gene Summary

• Gene Symbol: SLC22A8   Gene   UCSC   Ensembl
• Aliases: OAT3
• Gene name: solute carrier family 22 member 8
• Alternate names: solute carrier family 22 member 8, hOAT3, organic anion transporter 3, solute carrier family 22 (organic anion transporter), member 8,
• Gene location: 11q12.3 (63015844: 62992823)     Exons: 12     NC_000011.10
• Gene summary(Entrez): This gene encodes a protein involved in the sodium-independent transport and excretion of organic anions, some of which are potentially toxic. The encoded protein is an integral membrane protein and appears to be localized to the basolateral membrane of t

Protein Summary

• Protein general information: Q8TCC7  
  • Name: Solute carrier family 22 member 8 (Organic anion transporter 3) (hOAT3)
  • Length: 542  
  • Mass: 59856
  • Tissue specificity: Expressed in kidney. {ECO
• Sequence:

  MTFSEILDRVGSMGHFQFLHVAILGLPILNMANHNLLQIFTAATPVHHCRPPHNASTGPWVLPMGPNGKPERCLR
  FVHPPNASLPNDTQRAMEPCLDGWVYNSTKDSIVTEWDLVCNSNKLKEMAQSIFMAGILIGGLVLGDLSDRFGRR
  PILTCSYLLLAASGSGAAFSPTFPIYMVFRFLCGFGISGITLSTVILNVEWVPTRMRAIMSTALGYCYTFGQFIL
  PGLAYAIPQWRWLQLTVSIPFFVFFLSSWWTPESIRWLVLSGKSSKALKILRRVAVFNGKKEEGERLSLEELKLN
  LQKEISLAKAKYTASDLFRIPMLRRMTFCLSLAWFATGFAYYSLAMGVEEFGVNLYILQIIFGGVDVPAKFITIL
  SLSYLGRHTTQAAALLLAGGAILALTFVPLDLQTVRTVLAVFGKGCLSSSFSCLFLYTSELYPTVIRQTGMGVSN
  LWTRVGSMVSPLVKITGEVQPFIPNIIYGITALLGGSAALFLPETLNQPLPETIEDLENWSLRAKKPKQEPEVEK
  ASQRIPLQPHGPGLGSS

• Structural information:
  • Interpro: IPR020846  IPR005828  IPR036259  IPR004749  IPR005829  
  • Prosite: PS50850
  • STRING: ENSP00000337335
• Other Databases: GeneCards:  SLC22A8  Malacards:  SLC22A8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016323	basolateral plasma membrane	ISS	cellular component
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0016324	apical plasma membrane	ISS	cellular component
GO:0022857	transmembrane transporter activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0055085	transmembrane transport	IEA	biological process
GO:0009636	response to toxic substance	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0006811	ion transport	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0016323	basolateral plasma membrane	IEA	cellular component
GO:0015698	inorganic anion transport	IEA	biological process
GO:0005452	inorganic anion exchanger activity	IDA	molecular function
GO:0016323	basolateral plasma membrane	IDA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04976	Bile secretion

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq