• Gene id: 9373

Gene Summary

• Gene Symbol: PLAA   Gene   UCSC   Ensembl
• Aliases: DOA1, NDMSBA, PLA2P, PLAP
• Gene name: phospholipase A2 activating protein
• Alternate names: phospholipase A-2-activating protein, DOA1 homolog,
• Gene location: 9p21.2 (26947472: 26903371)     Exons: 15     NC_000009.12
• OMIM: 612960

Protein Summary

• Protein general information: Q9Y263  
  • Name: Phospholipase A 2 activating protein (PLA2P) (PLAP)
  • Length: 795  
  • Mass: 87157
• Sequence:

  MTSGATRYRLSCSLRGHELDVRGLVCCAYPPGAFVSVSRDRTTRLWAPDSPNRSFTEMHCMSGHSNFVSCVCIIP
  SSDIYPHGLIATGGNDHNICIFSLDSPMPLYILKGHKNTVCSLSSGKFGTLLSGSWDTTAKVWLNDKCMMTLQGH
  TAAVWAVKILPEQGLMLTGSADKTVKLWKAGRCERTFSGHEDCVRGLAILSETEFLSCANDASIRRWQITGECLE
  VYYGHTNYIYSISVFPNCRDFVTTAEDRSLRIWKHGECAQTIRLPAQSIWCCCVLDNGDIVVGASDGIIRVFTES
  EDRTASAEEIKAFEKELSHATIDSKTGDLGDINAEQLPGREHLNEPGTREGQTRLIRDGEKVEAYQWSVSEGRWI
  KIGDVVGSSGANQQTSGKVLYEGKEFDYVFSIDVNEGGPSYKLPYNTSDDPWLTAYNFLQKNDLNPMFLDQVAKF
  IIDNTKGQMLGLGNPSFSDPFTGGGRYVPGSSGSSNTLPTADPFTGAGRYVPGSASMGTTMAGVDPFTGNSAYRS
  AASKTMNIYFPKKEAVTFDQANPTQILGKLKELNGTAPEEKKLTEDDLILLEKILSLICNSSSEKPTVQQLQILW
  KAINCPEDIVFPALDILRLSIKHPSVNENFCNEKEGAQFSSHLINLLNPKGKPANQLLALRTFCNCFVGQAGQKL
  MMSQRESLMSHAIELKSGSNKNIHIALATLALNYSVCFHKDHNIEGKAQCLSLISTILEVVQDLEATFRLLVALG
  TLISDDSNAVQLAKSLGVDSQIKKYSSVSEPAKVSECCRFILNLL

• Structural information:
  • Protein Domains: (366..46-)
    (/note="PFU-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00727-)
    (533..79-)
    (/note="PUL-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00729"-)
  • Interpro: IPR011989  IPR016024  IPR015155  IPR038122  IPR033510   IPR013535  IPR015943  IPR001680  IPR017986  IPR036322  
  • Prosite: PS51394 PS51396 PS50082 PS50294
  • PDB: 2K89 2K8A 2K8B 2K8C 3EBB
  • PDBsum: 2K89 2K8A 2K8B 2K8C 3EBB
  • STRING: ENSP00000380460
• Other Databases: GeneCards:  PLAA  Malacards:  PLAA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0010992	ubiquitin recycling	IBA	biological process
GO:0043130	ubiquitin binding	IBA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IBA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0071222	cellular response to lipopolysaccharide	IMP	biological process
GO:0006693	prostaglandin metabolic process	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0016236	macroautophagy	IMP	biological process
GO:0045202	synapse	ISS	cellular component
GO:2001224	positive regulation of neuron migration	ISS	biological process
GO:1903861	positive regulation of dendrite extension	ISS	biological process
GO:1903423	positive regulation of synaptic vesicle recycling	ISS	biological process
GO:1900045	negative regulation of protein K63-linked ubiquitination	ISS	biological process
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	ISS	biological process
GO:0032430	positive regulation of phospholipase A2 activity	IMP	biological process
GO:0043130	ubiquitin binding	IEA	molecular function
GO:0043161	proteasome-mediated ubiquitin-dependent protein catabolic process	IEA	biological process
GO:0030054	cell junction	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007399	nervous system development	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007275	multicellular organism development	IEA	biological process
GO:0016005	phospholipase A2 activator activity	TAS	molecular function
GO:0006644	phospholipid metabolic process	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016005	phospholipase A2 activator activity	IEA	molecular function
GO:0006693	prostaglandin metabolic process	IEA	biological process
GO:0006954	inflammatory response	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:2001224	positive regulation of neuron migration	IEA	biological process
GO:1903861	positive regulation of dendrite extension	IEA	biological process
GO:1903423	positive regulation of synaptic vesicle recycling	IEA	biological process
GO:1900045	negative regulation of protein K63-linked ubiquitination	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0043162	ubiquitin-dependent protein catabolic process via the multivesicular body sorting pathway	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04141	Protein processing in endoplasmic reticulum

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray