• Gene id: 9371

Gene Summary

• Gene Symbol: KIF3B   Gene   UCSC   Ensembl
• Aliases: FLA8, HH0048, KLP-11
• Gene name: kinesin family member 3B
• Alternate names: kinesin-like protein KIF3B, microtubule plus end-directed kinesin motor 3B,
• Gene location: 20q11.21 (32277650: 32335010)     Exons: 9     NC_000020.11
• Gene summary(Entrez): The protein encoded by this gene acts as a heterodimer with kinesin family member 3A to aid in chromosome movement during mitosis and meiosis. The encoded protein is a plus end-directed microtubule motor and can interact with the SMC3 subunit of the cohes
• OMIM: 603754

Protein Summary

• Protein general information: O15066  
  • Name: Kinesin like protein KIF3B (HH0048) (Microtubule plus end directed kinesin motor 3B) [Cleaved into: Kinesin like protein KIF3B, N terminally processed]
  • Length: 747  
  • Mass: 85,125
• Sequence:

  MSKLKSSESVRVVVRCRPMNGKEKAASYDKVVDVDVKLGQVSVKNPKGTAHEMPKTFTFDAVYDWNAKQFELYDE
  TFRPLVDSVLQGFNGTIFAYGQTGTGKTYTMEGIRGDPEKRGVIPNSFDHIFTHISRSQNQQYLVRASYLEIYQE
  EIRDLLSKDQTKRLELKERPDTGVYVKDLSSFVTKSVKEIEHVMNVGNQNRSVGATNMNEHSSRSHAIFVITIEC
  SEVGLDGENHIRVGKLNLVDLAGSERQAKTGAQGERLKEATKINLSLSALGNVISALVDGKSTHIPYRDSKLTRL
  LQDSLGGNAKTVMVANVGPASYNVEETLTTLRYANRAKNIKNKPRVNEDPKDALLREFQEEIARLKAQLEKRSIG
  RRKRREKRREGGGSGGGGEEEEEEGEEGEEEGDDKDDYWREQQEKLEIEKRAIVEDHSLVAEEKMRLLKEKEKKM
  EDLRREKDAAEMLGAKIKAMESKLLVGGKNIVDHTNEQQKILEQKRQEIAEQKRREREIQQQMESRDEETLELKE
  TYSSLQQEVDIKTKKLKKLFSKLQAVKAEIHDLQEEHIKERQELEQTQNELTRELKLKHLIIENFIPLEEKSKIM
  NRAFFDEEEDHWKLHPITRLENQQMMKRPVSAVGYKRPLSQHARMSMMIRPEARYRAENIVLLELDMPSRTTRDY
  EGPAIAPKVQAALDAALQDEDEIQVDASSFESTANKKSKARPKSGRKSGSSSSSSGTPASQLYPQSRGLVPK

• Structural information:
  • Protein Domains: Kinesin (9-340)
  • Interpro: IPR027640  IPR019821  IPR001752  IPR036961  IPR027417  
  • Prosite: PS00411 PS50067
  • PDB: 3B6U
  • PDBsum: 3B6U
  • STRING: ENSP00000364864
• Other Databases: GeneCards:  KIF3B  Malacards:  KIF3B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003777	microtubule motor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005813	centrosome	NAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005873	plus-end kinesin complex	TAS	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to ER	TAS	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0007052	mitotic spindle organization	TAS	biological process
GO:0007100	mitotic centrosome separation	TAS	biological process
GO:0007368	determination of left/right symmetry	TAS	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0008089	anterograde axonal transport	TAS	biological process
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	TAS	molecular function
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016939	kinesin II complex	IDA	cellular component
GO:0017048	Rho GTPase binding	IPI	molecular function
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0030496	midbody	IEA	cellular component
GO:0030990	intraciliary transport particle	IEA	cellular component
GO:0032467	positive regulation of cytokinesis	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072383	plus-end-directed vesicle transport along microtubule	TAS	biological process
GO:0090307	mitotic spindle assembly	IMP	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:0005876	spindle microtubule	NAS	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0003777	microtubule motor activity	IEA	molecular function
GO:0003777	microtubule motor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0005813	centrosome	IEA	cellular component
GO:0005813	centrosome	NAS	cellular component
GO:0005819	spindle	IEA	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005873	plus-end kinesin complex	TAS	cellular component
GO:0005874	microtubule	IEA	cellular component
GO:0005929	cilium	IEA	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to ER	TAS	biological process
GO:0007018	microtubule-based movement	IEA	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0007052	mitotic spindle organization	TAS	biological process
GO:0007100	mitotic centrosome separation	TAS	biological process
GO:0007368	determination of left/right symmetry	TAS	biological process
GO:0008017	microtubule binding	IEA	molecular function
GO:0008089	anterograde axonal transport	TAS	biological process
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	TAS	molecular function
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016939	kinesin II complex	IEA	cellular component
GO:0016939	kinesin II complex	IDA	cellular component
GO:0017048	Rho GTPase binding	IPI	molecular function
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0030496	midbody	IEA	cellular component
GO:0030990	intraciliary transport particle	IEA	cellular component
GO:0032467	positive regulation of cytokinesis	IEA	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072383	plus-end-directed vesicle transport along microtubule	TAS	biological process
GO:0090307	mitotic spindle assembly	IMP	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:1904115	axon cytoplasm	IEA	cellular component
GO:0005876	spindle microtubule	NAS	cellular component
GO:0003777	microtubule motor activity	TAS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005813	centrosome	NAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005873	plus-end kinesin complex	TAS	cellular component
GO:0006890	retrograde vesicle-mediated transport, Golgi to ER	TAS	biological process
GO:0007018	microtubule-based movement	TAS	biological process
GO:0007052	mitotic spindle organization	TAS	biological process
GO:0007100	mitotic centrosome separation	TAS	biological process
GO:0007368	determination of left/right symmetry	TAS	biological process
GO:0008089	anterograde axonal transport	TAS	biological process
GO:0008574	ATP-dependent microtubule motor activity, plus-end-directed	TAS	molecular function
GO:0015630	microtubule cytoskeleton	IDA	cellular component
GO:0016020	membrane	IDA	cellular component
GO:0016939	kinesin II complex	IDA	cellular component
GO:0017048	Rho GTPase binding	IPI	molecular function
GO:0019886	antigen processing and presentation of exogenous peptide antigen via MHC class II	TAS	biological process
GO:0070062	extracellular exosome	IDA	cellular component
GO:0070062	extracellular exosome	IDA	cellular component
GO:0072383	plus-end-directed vesicle transport along microtubule	TAS	biological process
GO:0090307	mitotic spindle assembly	IMP	biological process
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0097542	ciliary tip	TAS	cellular component
GO:0005876	spindle microtubule	NAS	cellular component

Diseases

Associated diseases	References
Male factor infertility	MIK: 21898990
Asthenozoospermia	MIK: 21898990
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Asthenozoospermia	MIK: 21898990
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21898990	Asthenospermia				Male infertility	KIF3B MYO15A KIF6 KIF26B KIF3A DNHD2 DMN DYNC2H1 STARD9 MYOHD1 and TPM1
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881