• Gene id: 9370

Gene Summary

• Gene Symbol: ADIPOQ   Gene   UCSC   Ensembl
• Aliases: ACDC, ACRP30, ADIPQTL1, ADPN, APM-1, APM1, GBP28
• Gene name: adiponectin, C1Q and collagen domain containing
• Alternate names: adiponectin, 30 kDa adipocyte complement-related protein, adipocyte complement-related 30 kDa protein, adipose most abundant gene transcript 1 protein, adipose specific collagen-like factor, gelatin-binding protein 28,
• Gene location: 3q27.3 (186842709: 186858462)     Exons: 4     NC_000003.12
• Gene summary(Entrez): This gene is expressed in adipose tissue exclusively. It encodes a protein with similarity to collagens X and VIII and complement factor C1q. The encoded protein circulates in the plasma and is involved with metabolic and hormonal processes. Mutations in
• OMIM: 605441

Protein Summary

• Protein general information: Q15848  
  • Name: Adiponectin (30 kDa adipocyte complement related protein) (Adipocyte complement related 30 kDa protein) (ACRP30) (Adipocyte, C1q and collagen domain containing protein) (Adipose most abundant gene transcript 1 protein) (apM 1) (Gelatin binding protein)
  • Length: 244  
  • Mass: 26414
  • Tissue specificity: Synthesized exclusively by adipocytes and secreted into plasma. {ECO
• Sequence:

  MLLLGAVLLLLALPGHDQETTTQGPGVLLPLPKGACTGWMAGIPGHPGHNGAPGRDGRDGTPGEKGEKGDPGLIG
  PKGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIPNMPIRFTKIFYNQQNHYDGSTGKF
  HCNIPGLYYFAYHITVYMKDVKVSLFKKDKAMLFTYDQYQENNVDQASGSVLLHLEVGDQVWLQVYGEGERNGLY
  ADNDNDSTFTGFLLYHDTN

• Structural information:
  • Protein Domains: (42..10-)
    (/note="Collagen-like-)
    (108..24-)
    (/note="C1q-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00368"-)
  • Interpro: IPR001073  IPR008160  IPR008983  
  • Prosite: PS50871
  • PDB: 4DOU 6U66 6U6N
  • PDBsum: 4DOU 6U66 6U6N
  • STRING: ENSP00000389814
• Other Databases: GeneCards:  ADIPOQ  Malacards:  ADIPOQ

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005576	extracellular region	IEA	cellular component
GO:0005581	collagen trimer	IEA	cellular component
GO:0005179	hormone activity	IEA	molecular function
GO:0006091	generation of precursor metabolites and energy	TAS	biological process
GO:0042304	regulation of fatty acid biosynthetic process	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007623	circadian rhythm	IEA	biological process
GO:0009744	response to sucrose	IEA	biological process
GO:0031667	response to nutrient levels	IEA	biological process
GO:0042493	response to drug	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0045860	positive regulation of protein kinase activity	IEA	biological process
GO:0046888	negative regulation of hormone secretion	IEA	biological process
GO:0005102	signaling receptor binding	IEA	molecular function
GO:0005179	hormone activity	IEA	molecular function
GO:0009967	positive regulation of signal transduction	IEA	biological process
GO:0010467	gene expression	IEA	biological process
GO:0019395	fatty acid oxidation	IEA	biological process
GO:0042802	identical protein binding	IEA	molecular function
GO:0043407	negative regulation of MAP kinase activity	IEA	biological process
GO:0045721	negative regulation of gluconeogenesis	IEA	biological process
GO:0045923	positive regulation of fatty acid metabolic process	IEA	biological process
GO:0046326	positive regulation of glucose import	IEA	biological process
GO:0050728	negative regulation of inflammatory response	IEA	biological process
GO:0070994	detection of oxidative stress	IEA	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	IEA	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	IEA	biological process
GO:2000481	positive regulation of cAMP-dependent protein kinase activity	IEA	biological process
GO:2000534	positive regulation of renal albumin absorption	IEA	biological process
GO:2000584	negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	IEA	biological process
GO:0001666	response to hypoxia	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0007584	response to nutrient	IEA	biological process
GO:0014823	response to activity	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0032991	protein-containing complex	IEA	cellular component
GO:0045471	response to ethanol	IEA	biological process
GO:0050731	positive regulation of peptidyl-tyrosine phosphorylation	IEA	biological process
GO:0051384	response to glucocorticoid	IEA	biological process
GO:0070543	response to linoleic acid	IEA	biological process
GO:0071320	cellular response to cAMP	IEA	biological process
GO:0071872	cellular response to epinephrine stimulus	IEA	biological process
GO:2000467	positive regulation of glycogen (starch) synthase activity	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0006006	glucose metabolic process	IEA	biological process
GO:0006635	fatty acid beta-oxidation	IEA	biological process
GO:0009617	response to bacterium	IEA	biological process
GO:0009749	response to glucose	IEA	biological process
GO:0010642	negative regulation of platelet-derived growth factor receptor signaling pathway	IEA	biological process
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0032869	cellular response to insulin stimulus	IEA	biological process
GO:0035690	cellular response to drug	IEA	biological process
GO:0042593	glucose homeostasis	IEA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0045599	negative regulation of fat cell differentiation	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0050873	brown fat cell differentiation	IEA	biological process
GO:2000478	positive regulation of metanephric glomerular visceral epithelial cell development	IEA	biological process
GO:2000590	negative regulation of metanephric mesenchymal cell migration	IEA	biological process
GO:0005125	cytokine activity	NAS	molecular function
GO:0042803	protein homodimerization activity	IPI	molecular function
GO:0005179	hormone activity	IDA	molecular function
GO:0005102	signaling receptor binding	ISS	molecular function
GO:0042802	identical protein binding	TAS	molecular function
GO:0005615	extracellular space	IDA	cellular component
GO:0010745	negative regulation of macrophage derived foam cell differentiation	IDA	biological process
GO:0010804	negative regulation of tumor necrosis factor-mediated signaling pathway	IDA	biological process
GO:0010875	positive regulation of cholesterol efflux	IDA	biological process
GO:0030853	negative regulation of granulocyte differentiation	IDA	biological process
GO:0032270	positive regulation of cellular protein metabolic process	IDA	biological process
GO:0032720	negative regulation of tumor necrosis factor production	IDA	biological process
GO:0033034	positive regulation of myeloid cell apoptotic process	IDA	biological process
GO:0034612	response to tumor necrosis factor	IDA	biological process
GO:0043124	negative regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0045599	negative regulation of fat cell differentiation	IDA	biological process
GO:0045650	negative regulation of macrophage differentiation	IDA	biological process
GO:0050765	negative regulation of phagocytosis	IDA	biological process
GO:0006006	glucose metabolic process	ISS	biological process
GO:0006635	fatty acid beta-oxidation	ISS	biological process
GO:0009749	response to glucose	ISS	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:0009986	cell surface	IDA	cellular component
GO:0010739	positive regulation of protein kinase A signaling	IDA	biological process
GO:0034115	negative regulation of heterotypic cell-cell adhesion	IDA	biological process
GO:0034383	low-density lipoprotein particle clearance	IDA	biological process
GO:0045715	negative regulation of low-density lipoprotein particle receptor biosynthetic process	IDA	biological process
GO:0009967	positive regulation of signal transduction	ISS	biological process
GO:0045721	negative regulation of gluconeogenesis	ISS	biological process
GO:0045923	positive regulation of fatty acid metabolic process	ISS	biological process
GO:0046326	positive regulation of glucose import	ISS	biological process
GO:0050728	negative regulation of inflammatory response	NAS	biological process
GO:0005201	extracellular matrix structural constituent	RCA	molecular function
GO:0062023	collagen-containing extracellular matrix	HDA	cellular component
GO:0005576	extracellular region	HDA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0120162	positive regulation of cold-induced thermogenesis	ISS	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0120163	negative regulation of cold-induced thermogenesis	ISS	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:0007165	signal transduction	IEA	biological process
GO:2000279	negative regulation of DNA biosynthetic process	IDA	biological process
GO:0090317	negative regulation of intracellular protein transport	IDA	biological process
GO:0072659	protein localization to plasma membrane	IDA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0045776	negative regulation of blood pressure	IDA	biological process
GO:1904753	negative regulation of vascular associated smooth muscle cell migration	IDA	biological process
GO:0010642	negative regulation of platelet-derived growth factor receptor signaling pathway	IDA	biological process
GO:2000534	positive regulation of renal albumin absorption	IDA	biological process
GO:2000481	positive regulation of cAMP-dependent protein kinase activity	IDA	biological process
GO:0071639	positive regulation of monocyte chemotactic protein-1 production	IDA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0010906	regulation of glucose metabolic process	IDA	biological process
GO:0033691	sialic acid binding	IDA	molecular function
GO:0032757	positive regulation of interleukin-8 production	IDA	biological process
GO:0031953	negative regulation of protein autophosphorylation	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:2000481	positive regulation of cAMP-dependent protein kinase activity	IDA	biological process
GO:1900121	negative regulation of receptor binding	IDA	biological process
GO:0050805	negative regulation of synaptic transmission	IDA	biological process
GO:1904706	negative regulation of vascular smooth muscle cell proliferation	IDA	biological process
GO:0001934	positive regulation of protein phosphorylation	IDA	biological process
GO:2000467	positive regulation of glycogen (starch) synthase activity	ISS	biological process
GO:0050873	brown fat cell differentiation	ISS	biological process
GO:0042593	glucose homeostasis	ISS	biological process
GO:0030336	negative regulation of cell migration	ISS	biological process
GO:0006635	fatty acid beta-oxidation	ISS	biological process
GO:0006006	glucose metabolic process	ISS	biological process
GO:0005783	endoplasmic reticulum	ISS	cellular component
GO:2000584	negative regulation of platelet-derived growth factor receptor-alpha signaling pathway	ISS	biological process
GO:0019395	fatty acid oxidation	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:2000590	negative regulation of metanephric mesenchymal cell migration	ISS	biological process
GO:2000478	positive regulation of metanephric glomerular visceral epithelial cell development	ISS	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	ISS	biological process
GO:0035690	cellular response to drug	ISS	biological process
GO:0032869	cellular response to insulin stimulus	ISS	biological process
GO:0070994	detection of oxidative stress	ISS	biological process
GO:0050728	negative regulation of inflammatory response	ISS	biological process
GO:0043407	negative regulation of MAP kinase activity	ISS	biological process
GO:0005102	signaling receptor binding	ISS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04932	Non-alcoholic fatty liver disease
hsa04152	AMPK signaling pathway
hsa04211	Longevity regulating pathway
hsa03320	PPAR signaling pathway
hsa04920	Adipocytokine signaling pathway
hsa04930	Type II diabetes mellitus

Diseases

Associated diseases	References
Adiponectin deficiency	KEGG:H00967
Adiponectin deficiency	KEGG:H00967
Inflammatory bowel disease	PMID:18849144
Cardiomyopathy	PMID:21278397
Cardiomyopathy	PMID:23723143
Peripheral artery disease	PMID:16321391
Sleep apnea	PMID:19913847
tongue squamous cell carcinoma	PMID:23181352
Non-alcoholic fatty liver disease	PMID:15239085
Alzheimer's disease	PMID:22213409
Alzheimer's disease	PMID:20727007
primary open angle glaucoma	PMID:22553514
Polycystic ovary syndrome	PMID:16868149
Gestational diabetes	PMID:19626510
Rett syndrome	PMID:18710461
Graves' disease	PMID:20583542
Graves' disease	PMID:18997483
cardiovascular system disease	PMID:16822679
cardiovascular system disease	PMID:22207678
cardiovascular system disease	PMID:17893004
cardiovascular system disease	PMID:16644713
Dementia	PMID:22213409
Diabetic retinopathy	PMID:22563689
Behcet's disease	PMID:21044750
Kawasaki disease	PMID:16982510
Biliary atresia	PMID:21356120
Diffuse scleroderma	PMID:21615510
Breast cancer	PMID:17192291
Breast cancer	PMID:16019138
Breast cancer	PMID:18451143
Vascular disease	PMID:17893004
Atherosclerosis	PMID:12451000
Multiple sclerosis	PMID:20714168
prostate adenocarcinoma	PMID:21397927
Chronic obstructive pulmonary disease	PMID:21179920
Bipolar disorder	PMID:22137759
Coronary aneurysm	PMID:22683371
Coronary artery disease	PMID:17878891
congestive heart failure	PMID:22032915
hepatocellular carcinoma	PMID:23740135
Ankylosing spondylitis	PMID:21122270
Rheumatoid arthritis	PMID:21789720
Crohn's disease	PMID:16432373
Diabetic retinopathy	PMID:17970779
Diabetic retinopathy	PMID:24655058
Amyloidosis	PMID:22935190
type 2 diabetes mellitus	PMID:18472407
type 2 diabetes mellitus	PMID:28843383
type 2 diabetes mellitus	PMID:16822679
type 2 diabetes mellitus	PMID:19622782
type 2 diabetes mellitus	PMID:24655058
Fatty liver disease	PMID:20714777
Fatty liver disease	PMID:16115302
type 1 diabetes mellitus	PMID:19640330
obesity	PMID:18303100
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq