• Gene id: 9367

Gene Summary

• Gene Symbol: RAB9A   Gene   UCSC   Ensembl
• Aliases: RAB9
• Gene name: RAB9A, member RAS oncogene family
• Alternate names: ras-related protein Rab-9A, RAB9, member RAS oncogene family,
• Gene location: Xp22.2 (13689120: 13710503)     Exons: 3     NC_000023.11
• OMIM: 300284

Protein Summary

• Protein general information: P51151  
  • Name: Ras related protein Rab 9A
  • Length: 201  
  • Mass: 22838
• Sequence:

  MAGKSSLFKVILLGDGGVGKSSLMNRYVTNKFDTQLFHTIGVEFLNKDLEVDGHFVTMQIWDTAGQERFRSLRTP
  FYRGSDCCLLTFSVDDSQSFQNLSNWKKEFIYYADVKEPESFPFVILGNKIDISERQVSTEEAQAWCRDNGDYPY
  FETSAKDATNVAAAFEEAVRRVLATEDRSDHLIQTDTVNLHRKPKPSSSCC

• Structural information:
  • Interpro: IPR027417  IPR041824  IPR005225  IPR001806  
  • Prosite: PS51419
  • CDD: cd04116
  • PDB: 1WMS
  • PDBsum: 1WMS
  • DIP: 46409
  • STRING: ENSP00000420127
• Other Databases: GeneCards:  RAB9A  Malacards:  RAB9A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0032482	Rab protein signal transduction	IBA	biological process
GO:0012505	endomembrane system	IBA	cellular component
GO:0005764	lysosome	IBA	cellular component
GO:0003924	GTPase activity	IBA	molecular function
GO:0045335	phagocytic vesicle	IBA	cellular component
GO:0042147	retrograde transport, endosome to Golgi	IBA	biological process
GO:0006886	intracellular protein transport	IBA	biological process
GO:0005770	late endosome	IBA	cellular component
GO:0019003	GDP binding	IDA	molecular function
GO:0019003	GDP binding	IDA	molecular function
GO:0005525	GTP binding	IDA	molecular function
GO:0003924	GTPase activity	IDA	molecular function
GO:0045335	phagocytic vesicle	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0042470	melanosome	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0003924	GTPase activity	IEA	molecular function
GO:0005525	GTP binding	IEA	molecular function
GO:0032482	Rab protein signal transduction	IEA	biological process
GO:0005525	GTP binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0003924	GTPase activity	TAS	molecular function
GO:0005764	lysosome	IDA	cellular component
GO:0005770	late endosome	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0052405	negative regulation by host of symbiont molecular function	IMP	biological process
GO:0032880	regulation of protein localization	IMP	biological process
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0042802	identical protein binding	IEA	molecular function
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0042470	melanosome	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0005770	late endosome	IEA	cellular component
GO:0030670	phagocytic vesicle membrane	IEA	cellular component
GO:0005525	GTP binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0045921	positive regulation of exocytosis	IMP	biological process

KEGG pathways

Pathway id	Pathway name
hsa05132	Salmonella infection
hsa05162	Measles

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881