• Gene id: 93661

Gene Summary

• Gene Symbol: CAPZA3   Gene   UCSC   Ensembl
• Aliases: CAPPA3, Gsg3, HEL-S-86
• Gene name: capping actin protein of muscle Z-line alpha subunit 3
• Alternate names: F-actin-capping protein subunit alpha-3, CP-alpha-3, CapZ alpha-3, F-actin capping protein alpha-3 subunit, capping protein (actin filament) muscle Z-line, alpha 3, epididymis secretory protein Li 86, germ cell-specific protein 3, testis tissue sperm-bind,
• Gene location: 12p12.3 (18738110: 18739187)     Exons: 1     NC_000012.12
• Gene summary(Entrez): This gene encodes an actin capping protein, one of the F-actin capping protein alpha subunit family. The encoded protein is predominantly localized to the neck region of ejaculated sperm, other immunohistochemical signals were found in the tail and postac
• OMIM: 608722

Protein Summary

• Protein general information: Q96KX2  
  • Name: F actin capping protein subunit alpha 3 (CapZ alpha 3) (CP alpha 3) (Germ cell specific protein 3)
  • Length: 299  
  • Mass: 35,025
• Sequence:

  MTLSVLSRKDKERVIRRLLLQAPPGEFVNAFDDLCLLIRDEKLMHHQGECAGHQHCQKYSVPLCIDGNPVLLSHH
  NVMGDYRFFDHQSKLSFKYDLLQNQLKDIQSHGIIQNEAEYLRVVLLCALKLYVNDHYPKGNCNMLRKTVKSKEY
  LIACIEDHNYETGECWNGLWKSKWIFQVNPFLTQVTGRIFVQAHFFRCVNLHIEISKDLKESLEIVNQAQLALSF
  ARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII

• Structural information:
  • Interpro: IPR002189  IPR037282  IPR017865  
  • Prosite: PS00748 PS00749
  • STRING: ENSP00000326238
• Other Databases: GeneCards:  CAPZA3  Malacards:  CAPZA3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0007286	spermatid development	IEA	biological process
GO:0008290	F-actin capping protein complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030863	cortical cytoskeleton	IEA	cellular component
GO:0051016	barbed-end actin filament capping	IEA	biological process
GO:0001669	acrosomal vesicle	IEA	cellular component
GO:0003779	actin binding	IEA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0007286	spermatid development	IEA	biological process
GO:0008290	F-actin capping protein complex	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0030863	cortical cytoskeleton	IEA	cellular component
GO:0051016	barbed-end actin filament capping	IEA	biological process
GO:0051693	actin filament capping	IEA	biological process
GO:0005634	nucleus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis

Diseases

Associated diseases	References
Necrozoospermia	MIK: 18572863
Necrozoospermia	MIK: 18572863
Spermatogenic defects	MIK: 19341723
Necrozoospermia	MIK: 18572863
Non obstructive azoospermia	MIK: 24012201
Sertoli cell only syndrome	MIK: 23869807
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
18572863	Necrozoospermia			11 (10 healthy donors, 1 necrozoospermic patient)	Male infertility	Sperm protein (human accession No. 060904) zinc finger protein 174 (AW-1) F-actin capping protein alpha-3 subunit testis-specific inhibitor of apoptosis death domain receptor 3 soluble form (fragment) and peptide similar to the activator of CREM in t
19341723	Is essential for removal of the cytoplasm and maintenance of midpiece integrity during spermiation in the mouse				Male infertility
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
24012201	Non obstructive azoospermia			31 (4 controls, 27 cases)	Male infertility	GSE45885 analyzed by GEO2R (cutoff 1.5 fold)
23869807	Non obstructive azoospermia, Sertoli cell only syndrome			20 (4 controls, 16 cases)	Male infertility	GSE45887 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R