• Gene id: 93650

Gene Summary

• Gene Symbol: ACP4   Gene   UCSC   Ensembl
• Aliases: ACPT, AI1J
• Gene name: acid phosphatase 4
• Alternate names: testicular acid phosphatase, acid phosphatase, testicular,
• Gene location: 19q13.33 (50790414: 50795218)     Exons: 11     NC_000019.10
• Gene summary(Entrez): Acid phosphatases are enzymes capable of hydrolyzing orthophosphoric acid esters in an acid medium. This gene is up-regulated by androgens and is down-regulated by estrogens in the prostate cancer cell line. This gene exhibits a lower level of expression
• OMIM: 165162

Protein Summary

• Protein general information: Q9BZG2  
  • Name: Testicular acid phosphatase (EC 3.1.3.2) (Acid phosphatase 4)
  • Length: 426  
  • Mass: 46090
  • Tissue specificity: Expressed mainly in the testis. Also expressed in the brain where they are enriched at the postsynaptic sites. Expressed at lower levels in the trachea, prostate, bone marrow, spinal cord, colon, fetal brain, heart, thymus, fetal liver
• Sequence:

  MAGLGFWGHPAGPLLLLLLLVLPPRALPEGPLVFVALVFRHGDRAPLASYPMDPHKEVASTLWPRGLGQLTTEGV
  RQQLELGRFLRSRYEAFLSPEYRREEVYIRSTDFDRTLESAQANLAGLFPEAAPGSPEARWRPIPVHTVPVAEDK
  LLRFPMRSCPRYHELLREATEAAEYQEALEGWTGFLSRLENFTGLSLVGEPLRRAWKVLDTLMCQQAHGLPLPAW
  ASPDVLRTLAQISALDIGAHVGPPRAAEKAQLTGGILLNAILANFSRVQRLGLPLKMVMYSAHDSTLLALQGALG
  LYDGHTPPYAACLGFEFRKHLGNPAKDGGNVTVSLFYRNDSAHLPLPLSLPGCPAPCPLGRFYQLTAPARPPAHG
  VSCHGPYEAAIPPAPVVPLLAGAVAVLVALSLGLGLLAWRPGCLRALGGPV

• Structural information:
  • Interpro: IPR033379  IPR000560  IPR029033  
  • Prosite: PS00616 PS00778
  • CDD: cd07061
  • STRING: ENSP00000270593
• Other Databases: GeneCards:  ACP4  Malacards:  ACP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0042476	odontogenesis	IMP	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0003993	acid phosphatase activity	IEA	molecular function
GO:0045211	postsynaptic membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0004725	protein tyrosine phosphatase activity	IDA	molecular function
GO:1990264	peptidyl-tyrosine dephosphorylation involved in inactivation of protein kinase activity	IDA	biological process
GO:0048168	regulation of neuronal synaptic plasticity	IDA	biological process
GO:0030971	receptor tyrosine kinase binding	IDA	molecular function
GO:0010977	negative regulation of neuron projection development	IDA	biological process
GO:0120154	negative regulation of ERBB4 signaling pathway	IDA	biological process
GO:0010955	negative regulation of protein processing	IMP	biological process

Diseases

Associated diseases	References
Amelogenesis imperfecta	KEGG:H00615
Amelogenesis imperfecta	KEGG:H00615
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray