• Gene id: 9362

Gene Summary

• Gene Symbol: CPNE6   Gene   UCSC   Ensembl
• Gene name: copine 6
• Alternate names: copine-6, N-copine, copine VI (neuronal),
• Gene location: 14q11.2 (24069832: 24078099)     Exons: 15     NC_000014.9
• Gene summary(Entrez): This gene encodes a member of the copine family. Members of this family are calcium-dependent, phospholipid-binding proteins with C2 domains, two calcium- and phospholipid-binding domains. Through their domain structure and lipid binding capabilities, the

Protein Summary

• Protein general information: O95741  
  • Name: Copine 6 (Copine VI) (Neuronal copine) (N copine)
  • Length: 557  
  • Mass: 61991
  • Tissue specificity: Widely expressed in the brain (PubMed
• Sequence:

  MSDPEMGWVPEPPTMTLGASRVELRVSCHGLLDRDTLTKPHPCVLLKLYSDEQWVEVERTEVLRSCSSPVFSRVL
  ALEYFFEEKQPLQFHVFDAEDGATSPRNDTFLGSTECTLGQIVSQTKVTKPLLLKNGKTAGKSTITIVAEEVSGT
  NDYVQLTFRAYKLDNKDLFSKSDPFMEIYKTNEDQSDQLVWRTEVVKNNLNPSWEPFRLSLHSLCSCDVHRPLKF
  LVYDYDSSGKHDFIGEFTSTFQEMQEGTANPGQEMQWDCINPKYRDKKKNYKSSGTVVLAQCTVEKVHTFLDYIM
  GGCQISFTVAIDFTASNGDPRSSQSLHCLSPRQPNHYLQALRAVGGICQDYDSDKRFPAFGFGARIPPNFEVSHD
  FAINFDPENPECEEISGVIASYRRCLPQIQLYGPTNVAPIINRVAEPAQREQSTGQATKYSVLLVLTDGVVSDMA
  ETRTAIVRASRLPMSIIIVGVGNADFSDMRLLDGDDGPLRCPRGVPAARDIVQFVPFRDFKDAAPSALAKCVLAE
  VPRQVVEYYASQGISPGAPRPCTLATTPSPSP

• Structural information:
  • Protein Domains: (2..12-)
    (/note="C2-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (134..26-)
    (/note="C2-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00041-)
    (306..52-)
    (/note="VWFA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00219"-)
  • Interpro: IPR000008  IPR035892  IPR037768  IPR010734  IPR002035   IPR036465  
  • Prosite: PS50004 PS50234
  • CDD: cd04047 cd01459
  • STRING: ENSP00000440077
• Other Databases: GeneCards:  CPNE6  Malacards:  CPNE6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IBA	cellular component
GO:0071277	cellular response to calcium ion	IBA	biological process
GO:0005544	calcium-dependent phospholipid binding	IBA	molecular function
GO:0030425	dendrite	ISS	cellular component
GO:0030424	axon	ISS	cellular component
GO:0001786	phosphatidylserine binding	ISS	molecular function
GO:0016020	membrane	ISS	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0030154	cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005215	transporter activity	TAS	molecular function
GO:0005509	calcium ion binding	TAS	molecular function
GO:0006629	lipid metabolic process	TAS	biological process
GO:0007399	nervous system development	TAS	biological process
GO:0007268	chemical synaptic transmission	TAS	biological process
GO:0016192	vesicle-mediated transport	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0046474	glycerophospholipid biosynthetic process	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0071277	cellular response to calcium ion	IEA	biological process
GO:0045334	clathrin-coated endocytic vesicle	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0001786	phosphatidylserine binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0043204	perikaryon	IEA	cellular component
GO:0030136	clathrin-coated vesicle	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:1903861	positive regulation of dendrite extension	IDA	biological process
GO:0070062	extracellular exosome	HDA	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881