• Gene id: 93587

Gene Summary

• Gene Symbol: TRMT10A   Gene   UCSC   Ensembl
• Aliases: HEL-S-88, MSSGM, MSSGM1, RG9MTD2, TRM10
• Gene name: tRNA methyltransferase 10A
• Alternate names: tRNA methyltransferase 10 homolog A, RNA (guanine-9-)-methyltransferase domain-containing protein 2, epididymis secretory protein Li 88, tRNA (guanine(9)-N(1))-methyltransferase TRMT10A,
• Gene location: 4q23 (99564038: 99546710)     Exons: 9     NC_000004.12
• Gene summary(Entrez): This gene encodes a protein that belongs to the tRNA (Guanine-1)-methyltransferase family. A similar gene in yeast modifies several different tRNA species. Mutations in this gene are associated with microcephaly, short stature, and impaired glucose metabo
• OMIM: 616888

Protein Summary

• Protein general information: Q8TBZ6  
  • Name: tRNA methyltransferase 10 homolog A (EC 2.1.1.221) (RNA (guanine 9 ) methyltransferase domain containing protein 2) (tRNA (guanine(9) N(1)) methyltransferase TRMT10A)
  • Length: 339  
  • Mass: 39719
  • Tissue specificity: Expressed in embryonic and fetal brain. It is expressed throughout the dorsal telencephalon at 8 and 11 weeks of gestation, with highest expression in ventricular zone and marginal zone. Detected in cerebellar cortex and nuclei, but no
• Sequence:

  MSSEMLPAFIETSNVDKKQGINEDQEESQKPRLGEGCEPISKRQMKKLIKQKQWEEQRELRKQKRKEKRKRKKLE
  RQCQMEPNSDGHDRKRVRRDVVHSTLRLIIDCSFDHLMVLKDIKKLHKQIQRCYAENRRALHPVQFYLTSHGGQL
  KKNMDENDKGWVNWKDIHIKPEHYSELIKKEDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDY
  GINHAQLPLGNFVKMNSRKVLAVNHVFEIILEYLETRDWQEAFFTILPQRKGAVPTDKACESASHDNQSVRMEEG
  GSDSDSSEEEYSRNELDSPHEEKQDKENHTESTVNSLPH

• Structural information:
  • Protein Domains: (89..27-)
    TRM10-type (/note="SAM-dependent-MTase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01012"-)
  • Interpro: IPR028564  IPR038459  IPR016653  IPR007356  IPR016009  
  • Prosite: PS51675
  • PDB: 4FMW
  • PDBsum: 4FMW
  • STRING: ENSP00000273962
• Other Databases: GeneCards:  TRMT10A  Malacards:  TRMT10A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0090646	mitochondrial tRNA processing	IBA	biological process
GO:0009019	tRNA (guanine-N1-)-methyltransferase activity	IBA	molecular function
GO:0005829	cytosol	IBA	cellular component
GO:0005654	nucleoplasm	IBA	cellular component
GO:0000049	tRNA binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0030488	tRNA methylation	IDA	biological process
GO:0000049	tRNA binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0032259	methylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0008168	methyltransferase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0052905	tRNA (guanine(9)-N(1))-methyltransferase activity	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005730	nucleolus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0015629	actin cytoskeleton	IDA	cellular component
GO:0005739	mitochondrion	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0009019	tRNA (guanine-N1-)-methyltransferase activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Microcephaly, short stature, and impaired glucose metabolism	KEGG:H01923
Microcephaly, short stature, and impaired glucose metabolism	KEGG:H01923
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881