• Gene id: 9353

Gene Summary

• Gene Symbol: SLIT2   Gene   UCSC   Ensembl
• Aliases: SLIL3, Slit-2
• Gene name: slit guidance ligand 2
• Alternate names: slit homolog 2 protein,
• Gene location: 4p15.31 (20251904: 20620560)     Exons: 40     NC_000004.12
• Gene summary(Entrez): This gene encodes a member of the slit family of secreted glycoproteins, which are ligands for the Robo family of immunoglobulin receptors. Slit proteins play highly conserved roles in axon guidance and neuronal migration and may also have functions durin

Protein Summary

• Protein general information: O94813  
  • Name: Slit homolog 2 protein (Slit 2) [Cleaved into: Slit homolog 2 protein N product; Slit homolog 2 protein C product]
  • Length: 1529  
  • Mass: 169870
  • Tissue specificity: Fetal lung and kidney, and adult spinal cord. Weak expression in adult adrenal gland, thyroid, trachea and other tissues examined. {ECO
• Sequence:

  MRGVGWQMLSLSLGLVLAILNKVAPQACPAQCSCSGSTVDCHGLALRSVPRNIPRNTERLDLNGNNITRITKTDF
  AGLRHLRVLQLMENKISTIERGAFQDLKELERLRLNRNHLQLFPELLFLGTAKLYRLDLSENQIQAIPRKAFRGA
  VDIKNLQLDYNQISCIEDGAFRALRDLEVLTLNNNNITRLSVASFNHMPKLRTFRLHSNNLYCDCHLAWLSDWLR
  QRPRVGLYTQCMGPSHLRGHNVAEVQKREFVCSGHQSFMAPSCSVLHCPAACTCSNNIVDCRGKGLTEIPTNLPE
  TITEIRLEQNTIKVIPPGAFSPYKKLRRIDLSNNQISELAPDAFQGLRSLNSLVLYGNKITELPKSLFEGLFSLQ
  LLLLNANKINCLRVDAFQDLHNLNLLSLYDNKLQTIAKGTFSPLRAIQTMHLAQNPFICDCHLKWLADYLHTNPI
  ETSGARCTSPRRLANKRIGQIKSKKFRCSAKEQYFIPGTEDYRSKLSGDCFADLACPEKCRCEGTTVDCSNQKLN
  KIPEHIPQYTAELRLNNNEFTVLEATGIFKKLPQLRKINFSNNKITDIEEGAFEGASGVNEILLTSNRLENVQHK
  MFKGLESLKTLMLRSNRITCVGNDSFIGLSSVRLLSLYDNQITTVAPGAFDTLHSLSTLNLLANPFNCNCYLAWL
  GEWLRKKRIVTGNPRCQKPYFLKEIPIQDVAIQDFTCDDGNDDNSCSPLSRCPTECTCLDTVVRCSNKGLKVLPK
  GIPRDVTELYLDGNQFTLVPKELSNYKHLTLIDLSNNRISTLSNQSFSNMTQLLTLILSYNRLRCIPPRTFDGLK
  SLRLLSLHGNDISVVPEGAFNDLSALSHLAIGANPLYCDCNMQWLSDWVKSEYKEPGIARCAGPGEMADKLLLTT
  PSKKFTCQGPVDVNILAKCNPCLSNPCKNDGTCNSDPVDFYRCTCPYGFKGQDCDVPIHACISNPCKHGGTCHLK
  EGEEDGFWCICADGFEGENCEVNVDDCEDNDCENNSTCVDGINNYTCLCPPEYTGELCEEKLDFCAQDLNPCQHD
  SKCILTPKGFKCDCTPGYVGEHCDIDFDDCQDNKCKNGAHCTDAVNGYTCICPEGYSGLFCEFSPPMVLPRTSPC
  DNFDCQNGAQCIVRINEPICQCLPGYQGEKCEKLVSVNFINKESYLQIPSAKVRPQTNITLQIATDEDSGILLYK
  GDKDHIAVELYRGRVRASYDTGSHPASAIYSVETINDGNFHIVELLALDQSLSLSVDGGNPKIITNLSKQSTLNF
  DSPLYVGGMPGKSNVASLRQAPGQNGTSFHGCIRNLYINSELQDFQKVPMQTGILPGCEPCHKKVCAHGTCQPSS
  QAGFTCECQEGWMGPLCDQRTNDPCLGNKCVHGTCLPINAFSYSCKCLEGHGGVLCDEEEDLFNPCQAIKCKHGK
  CRLSGLGQPYCECSSGYTGDSCDREISCRGERIRDYYQKQQGYAACQTTKKVSRLECRGGCAGGQCCGPLRSKRR
  KYSFECTDGSSFVDEVEKVVKCGCTRCVS

• Structural information:
  • Protein Domains: (31..5-)
    (/note="LRRNT-)
    (209..25-)
    (/note="LRRCT-1)
    (264..30-)
    (/note="LRRNT-2)
    (430..48-)
    (/note="LRRCT-2)
    (497..53-)
    (/note="LRRNT-3)
    (664..71-)
    (/note="LRRCT-3)
    (718..75-)
    (/note="LRRNT-4)
    (859..90-)
  • Interpro: IPR013320  IPR000483  IPR006207  IPR001881  IPR013032   IPR000742  IPR000152  IPR018097  IPR003645  IPR001791  IPR001611  IPR003591  IPR032675  IPR000372  
  • Prosite: PS00010 PS01185 PS01225 PS00022 PS01186 PS50026 PS01187 PS50025 PS51450
  • PDB: 2V70 2V9S 2V9T 2WFH
  • PDBsum: 2V70 2V9S 2V9T 2WFH
  • DIP: 38198
  • STRING: ENSP00000422591
• Other Databases: GeneCards:  SLIT2  Malacards:  SLIT2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007411	axon guidance	IBA	biological process
GO:0008201	heparin binding	IBA	molecular function
GO:0048495	Roundabout binding	IBA	molecular function
GO:0050919	negative chemotaxis	IBA	biological process
GO:0030308	negative regulation of cell growth	IBA	biological process
GO:0031290	retinal ganglion cell axon guidance	IBA	biological process
GO:0005509	calcium ion binding	IEA	molecular function
GO:0030154	cell differentiation	IEA	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0008201	heparin binding	IEA	molecular function
GO:0006935	chemotaxis	IEA	biological process
GO:0007275	multicellular organism development	IEA	biological process
GO:0007399	nervous system development	IEA	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007411	axon guidance	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0005576	extracellular region	TAS	cellular component
GO:0042802	identical protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003184	pulmonary valve morphogenesis	ISS	biological process
GO:0003180	aortic valve morphogenesis	ISS	biological process
GO:0060412	ventricular septum morphogenesis	ISS	biological process
GO:0014912	negative regulation of smooth muscle cell migration	IDA	biological process
GO:0071676	negative regulation of mononuclear cell migration	IDA	biological process
GO:0030308	negative regulation of cell growth	IMP	biological process
GO:0090027	negative regulation of monocyte chemotaxis	ISS	biological process
GO:0035385	Roundabout signaling pathway	IC	biological process
GO:0071672	negative regulation of smooth muscle cell chemotaxis	IDA	biological process
GO:0090288	negative regulation of cellular response to growth factor stimulus	IDA	biological process
GO:0002042	cell migration involved in sprouting angiogenesis	IMP	biological process
GO:0021972	corticospinal neuron axon guidance through spinal cord	IMP	biological process
GO:0035385	Roundabout signaling pathway	IMP	biological process
GO:0070100	negative regulation of chemokine-mediated signaling pathway	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0034260	negative regulation of GTPase activity	IEA	biological process
GO:0090024	negative regulation of neutrophil chemotaxis	IDA	biological process
GO:0071504	cellular response to heparin	IDA	biological process
GO:0051058	negative regulation of small GTPase mediated signal transduction	IDA	biological process
GO:0048846	axon extension involved in axon guidance	IDA	biological process
GO:0042803	protein homodimerization activity	IDA	molecular function
GO:0031290	retinal ganglion cell axon guidance	IDA	biological process
GO:0031290	retinal ganglion cell axon guidance	IDA	biological process
GO:0030336	negative regulation of cell migration	IDA	biological process
GO:0021834	chemorepulsion involved in embryonic olfactory bulb interneuron precursor migration	IDA	NOT|biological process
GO:0001933	negative regulation of protein phosphorylation	IDA	biological process
GO:0050929	induction of negative chemotaxis	IDA	biological process
GO:0050919	negative chemotaxis	IDA	biological process
GO:0010593	negative regulation of lamellipodium assembly	IDA	biological process
GO:0008201	heparin binding	IDA	molecular function
GO:0008045	motor neuron axon guidance	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0005095	GTPase inhibitor activity	IDA	molecular function
GO:0002689	negative regulation of leukocyte chemotaxis	IDA	biological process
GO:0090260	negative regulation of retinal ganglion cell axon guidance	IDA	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IDA	biological process
GO:0043237	laminin-1 binding	IDA	molecular function
GO:0043116	negative regulation of vascular permeability	IDA	biological process
GO:0030837	negative regulation of actin filament polymerization	IDA	biological process
GO:0010596	negative regulation of endothelial cell migration	IDA	biological process
GO:0005615	extracellular space	IDA	cellular component
GO:0005615	extracellular space	IDA	cellular component
GO:0021836	chemorepulsion involved in postnatal olfactory bulb interneuron migration	IDA	biological process
GO:0007411	axon guidance	IDA	biological process
GO:0005095	GTPase inhibitor activity	IDA	molecular function
GO:0070062	extracellular exosome	HDA	cellular component
GO:0051414	response to cortisol	IEP	biological process
GO:0050772	positive regulation of axonogenesis	TAS	biological process
GO:0048754	branching morphogenesis of an epithelial tube	IMP	biological process
GO:0061364	apoptotic process involved in luteolysis	IEP	biological process
GO:0050919	negative chemotaxis	IMP	biological process
GO:0048495	Roundabout binding	IPI	molecular function
GO:0048495	Roundabout binding	IPI	molecular function
GO:0048495	Roundabout binding	IPI	molecular function
GO:0043394	proteoglycan binding	IPI	molecular function
GO:0030336	negative regulation of cell migration	IMP	biological process
GO:0005509	calcium ion binding	NAS	molecular function
GO:0001657	ureteric bud development	IMP	biological process
GO:0048495	Roundabout binding	IPI	molecular function
GO:0048495	Roundabout binding	IPI	molecular function
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0032870	cellular response to hormone stimulus	IEP	biological process
GO:0016020	membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04360	Axon guidance

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq