• Gene id: 9350

Gene Summary

• Gene Symbol: CER1   Gene   UCSC   Ensembl
• Aliases: DAND4
• Gene name: cerberus 1, DAN family BMP antagonist
• Alternate names: cerberus, DAN domain family member 4, cerberus 1, cysteine knot superfamily, homolog, cerberus-related 1, cerberus-related protein,
• Gene location: 9p22.3 (128879489: 128913113)     Exons: 18     NC_000003.12
• Gene summary(Entrez): This gene encodes a cytokine member of the cysteine knot superfamily, characterized by nine conserved cysteines and a cysteine knot region. The cerberus-related cytokines, together with Dan and DRM/Gremlin, represent a group of bone morphogenetic protein
• OMIM: 603777

Protein Summary

• Protein general information: O95813  
  • Name: Cerberus (Cerberus related protein) (DAN domain family member 4)
  • Length: 267  
  • Mass: 30084
• Sequence:

  MHLLLFQLLVLLPLGKTTRHQDGRQNQSSLSPVLLPRNQRELPTGNHEEAEEKPDLFVAVPHLVATSPAGEGQRQ
  REKMLSRFGRFWKKPEREMHPSRDSDSEPFPPGTQSLIQPIDGMKMEKSPLREEAKKFWHHFMFRKTPASQGVIL
  PIKSHEVHWETCRTVPFSQTITHEGCEKVVVQNNLCFGKCGSVHFPGAAQHSHTSCSHCLPAKFTTMHLPLNCTE
  LSSVIKVVMLVEECQCKVKTEHEDGHILHAGSQDSFIPGVSA

• Structural information:
  • Protein Domains: (162..24-)
    (/note="CTCK-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00039"-)
  • Interpro: IPR016860  IPR006207  IPR029034  IPR004133  
  • Prosite: PS01225
  • STRING: ENSP00000370297
• Other Databases: GeneCards:  CER1  Malacards:  CER1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005615	extracellular space	IBA	cellular component
GO:0016015	morphogen activity	IBA	molecular function
GO:0023019	signal transduction involved in regulation of gene expression	IBA	biological process
GO:0035582	sequestering of BMP in extracellular matrix	IBA	biological process
GO:0061371	determination of heart left/right asymmetry	IBA	biological process
GO:1900176	negative regulation of nodal signaling pathway involved in determination of lateral mesoderm left/right asymmetry	IBA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005125	cytokine activity	IEA	molecular function
GO:0030509	BMP signaling pathway	TAS	biological process
GO:0005576	extracellular region	TAS	cellular component
GO:0042803	protein homodimerization activity	IEA	molecular function
GO:0042074	cell migration involved in gastrulation	IEA	biological process
GO:0035582	sequestering of BMP in extracellular matrix	IEA	biological process
GO:0032926	negative regulation of activin receptor signaling pathway	IEA	biological process
GO:0023019	signal transduction involved in regulation of gene expression	IEA	biological process
GO:0009952	anterior/posterior pattern specification	IEA	biological process
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0005615	extracellular space	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0003419	growth plate cartilage chondrocyte proliferation	IEA	biological process
GO:0001657	ureteric bud development	IEA	biological process
GO:0071773	cellular response to BMP stimulus	IEA	biological process
GO:2000381	negative regulation of mesoderm development	IEA	biological process
GO:0030514	negative regulation of BMP signaling pathway	IEA	biological process
GO:0009948	anterior/posterior axis specification	IEA	biological process
GO:0007369	gastrulation	IEA	biological process
GO:0016015	morphogen activity	IDA	molecular function
GO:0036122	BMP binding	IDA	molecular function
GO:0042803	protein homodimerization activity	ISS	molecular function
GO:0032926	negative regulation of activin receptor signaling pathway	IDA	biological process
GO:0035582	sequestering of BMP in extracellular matrix	IDA	biological process
GO:0003419	growth plate cartilage chondrocyte proliferation	ISS	biological process
GO:0005576	extracellular region	ISS	cellular component
GO:0005615	extracellular space	ISS	cellular component
GO:0008285	negative regulation of cell population proliferation	ISS	biological process
GO:0009952	anterior/posterior pattern specification	ISS	biological process
GO:0023019	signal transduction involved in regulation of gene expression	ISS	biological process
GO:0032926	negative regulation of activin receptor signaling pathway	ISS	biological process
GO:0035582	sequestering of BMP in extracellular matrix	ISS	biological process
GO:0042074	cell migration involved in gastrulation	ISS	biological process
GO:0071773	cellular response to BMP stimulus	ISS	biological process
GO:0007369	gastrulation	ISS	biological process
GO:0007399	nervous system development	IMP	biological process
GO:0009948	anterior/posterior axis specification	ISS	biological process
GO:0030178	negative regulation of Wnt signaling pathway	ISS	NOT|biological process
GO:0030282	bone mineralization	IMP	biological process
GO:0030514	negative regulation of BMP signaling pathway	ISS	biological process
GO:0048263	determination of dorsal identity	IMP	biological process
GO:2000381	negative regulation of mesoderm development	ISS	biological process
GO:2000381	negative regulation of mesoderm development	IMP	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0001657	ureteric bud development	ISS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04310	Wnt signaling pathway

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)