• Gene id: 9344

Gene Summary

• Gene Symbol: TAOK2   Gene   UCSC   Ensembl
• Aliases: MAP3K17, PSK, PSK1, PSK1-BETA, TAO1, TAO2
• Gene name: TAO kinase 2
• Alternate names: serine/threonine-protein kinase TAO2, PSK-1, hKFC-C, kinase from chicken homolog C, prostate derived STE20-like kinase PSK, prostate-derived STE20-like kinase 1, prostate-derived sterile 20-like kinase 1, thousand and one amino acid protein kinase 2,
• Gene location: 16p11.2 (29973867: 29992260)     Exons: 20     NC_000016.10
• Gene summary(Entrez): This gene encodes a serine/threonine protein kinase that is involved in many different processes, including, cell signaling, microtubule organization and stability, and apoptosis. Alternatively spliced transcript variants encoding different isoforms have
• OMIM: 613199

Protein Summary

• Protein general information: Q9UL54  
  • Name: Serine/threonine protein kinase TAO2 (EC 2.7.11.1) (Kinase from chicken homolog C) (hKFC C) (Prostate derived sterile 20 like kinase 1) (PSK 1) (PSK1) (Prostate derived STE20 like kinase 1) (Thousand and one amino acid protein kinase 2)
  • Length: 1235  
  • Mass: 138251
  • Tissue specificity: Ubiquitously expressed, with a higher level of expression in testis and brain. {ECO
• Sequence:

  MPAGGRAGSLKDPDVAELFFKDDPEKLFSDLREIGHGSFGAVYFARDVRNSEVVAIKKMSYSGKQSNEKWQDIIK
  EVRFLQKLRHPNTIQYRGCYLREHTAWLVMEYCLGSASDLLEVHKKPLQEVEIAAVTHGALQGLAYLHSHNMIHR
  DVKAGNILLSEPGLVKLGDFGSASIMAPANSFVGTPYWMAPEVILAMDEGQYDGKVDVWSLGITCIELAERKPPL
  FNMNAMSALYHIAQNESPVLQSGHWSEYFRNFVDSCLQKIPQDRPTSEVLLKHRFVLRERPPTVIMDLIQRTKDA
  VRELDNLQYRKMKKILFQEAPNGPGAEAPEEEEEAEPYMHRAGTLTSLESSHSVPSMSISASSQSSSVNSLADAS
  DNEEEEEEEEEEEEEEEGPEAREMAMMQEGEHTVTSHSSIIHRLPGSDNLYDDPYQPEITPSPLQPPAAPAPTST
  TSSARRRAYCRNRDHFATIRTASLVSRQIQEHEQDSALREQLSGYKRMRRQHQKQLLALESRLRGEREEHSARLQ
  RELEAQRAGFGAEAEKLARRHQAIGEKEARAAQAEERKFQQHILGQQKKELAALLEAQKRTYKLRKEQLKEELQE
  NPSTPKREKAEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDL
  ECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQKHAAQVRQQPKSLKVRAGQR
  PPGLPLPIPGALGPPNTGTPIEQQPCSPGQEAVLDQRMLGEEEEAVGERRILGKEGATLEPKQQRILGEESGAPS
  PSPQKHGSLVDEEVWGLPEEIEELRVPSLVPQERSIVGQEEAGTWSLWGKEDESLLDEEFELGWVQGPALTPVPE
  EEEEEEEGAPIGTPRDPGDGCPSPDIPPEPPPTHLRPCPASQLPGLLSHGLLAGLSFAVGSSSGLLPLLLLLLLP
  LLAAQGGGGLQAALLALEVGLVGLGASYLLLCTALHLPSSLFLLLAQGTALGAVLGLSWRRGLMGVPLGLGAAWL
  LAWPGLALPLVAMAAGGRWVRQQGPRVRRGISRLWLRVLLRLSPMAFRALQGCGAVGDRGLFALYPKTNKDGFRS
  RLPVPGPRRRNPRTTQHPLALLARVWVLCKGWNWRLARASQGLASHLPPWAIHTLASWGLLRGERPTRIPRLLPR
  SQRQLGPPASRQPLPGTLAGRRSRTRQSRALPPWR

• Structural information:
  • Protein Domains: (28..28-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • STRING: ENSP00000310094
• Other Databases: GeneCards:  TAOK2  Malacards:  TAOK2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004709	MAP kinase kinase kinase activity	NAS	molecular function
GO:0048156	tau protein binding	NAS	molecular function
GO:0050321	tau-protein kinase activity	NAS	molecular function
GO:0004674	protein serine/threonine kinase activity	NAS	molecular function
GO:0038191	neuropilin binding	IPI	molecular function
GO:0150020	basal dendrite arborization	ISS	biological process
GO:0150019	basal dendrite morphogenesis	ISS	biological process
GO:0007409	axonogenesis	IGI	biological process
GO:0007409	axonogenesis	ISS	biological process
GO:0044295	axonal growth cone	ISS	cellular component
GO:0015629	actin cytoskeleton	ISS	colocalizes with
GO:0030424	axon	ISS	cellular component
GO:0043005	neuron projection	ISS	cellular component
GO:0044294	dendritic growth cone	ISS	cellular component
GO:0000187	activation of MAPK activity	TAS	biological process
GO:0046777	protein autophosphorylation	TAS	biological process
GO:0031954	positive regulation of protein autophosphorylation	TAS	biological process
GO:0046330	positive regulation of JNK cascade	ISS	biological process
GO:0032147	activation of protein kinase activity	TAS	biological process
GO:0032956	regulation of actin cytoskeleton organization	ISS	biological process
GO:0032147	activation of protein kinase activity	IBA	biological process
GO:0007346	regulation of mitotic cell cycle	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0000186	activation of MAPKK activity	IBA	biological process
GO:0031098	stress-activated protein kinase signaling cascade	IBA	biological process
GO:0023014	signal transduction by protein phosphorylation	IBA	biological process
GO:0004709	MAP kinase kinase kinase activity	IBA	molecular function
GO:0051403	stress-activated MAPK cascade	IDA	biological process
GO:0006974	cellular response to DNA damage stimulus	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0032874	positive regulation of stress-activated MAPK cascade	IMP	biological process
GO:0007095	mitotic G2 DNA damage checkpoint	IMP	biological process
GO:0031434	mitogen-activated protein kinase kinase binding	IPI	molecular function
GO:0031434	mitogen-activated protein kinase kinase binding	IPI	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0016301	kinase activity	IEA	molecular function
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007409	axonogenesis	IEA	biological process
GO:0032956	regulation of actin cytoskeleton organization	IEA	biological process
GO:0038191	neuropilin binding	IEA	molecular function
GO:0044294	dendritic growth cone	IEA	cellular component
GO:0046330	positive regulation of JNK cascade	IEA	biological process
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0030424	axon	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0044295	axonal growth cone	IEA	cellular component
GO:0150019	basal dendrite morphogenesis	IEA	biological process
GO:0150020	basal dendrite arborization	IEA	biological process
GO:0030659	cytoplasmic vesicle membrane	IEA	cellular component
GO:0030425	dendrite	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0031410	cytoplasmic vesicle	IDA	cellular component
GO:0046330	positive regulation of JNK cascade	IDA	biological process
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0048041	focal adhesion assembly	IDA	biological process
GO:0030036	actin cytoskeleton organization	IDA	biological process
GO:0008360	regulation of cell shape	IDA	biological process
GO:0000186	activation of MAPKK activity	IDA	biological process
GO:0006612	protein targeting to membrane	NAS	biological process
GO:0001558	regulation of cell growth	NAS	biological process
GO:0016477	cell migration	NAS	biological process
GO:0006915	apoptotic process	NAS	biological process

KEGG pathways

Pathway id	Pathway name
hsa04010	MAPK signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray