• Gene id: 9341

Gene Summary

• Gene Symbol: VAMP3   Gene   UCSC   Ensembl
• Aliases: CEB
• Gene name: vesicle associated membrane protein 3
• Alternate names: vesicle-associated membrane protein 3, VAMP-3, cellubrevin, synaptobrevin-3,
• Gene location: 1p36.23 (7771274: 7781431)     Exons: 22     NC_000001.11
• Gene summary(Entrez): Synaptobrevins/VAMPs, syntaxins, and the 25-kD synaptosomal-associated protein are the main components of a protein complex involved in the docking and/or fusion of synaptic vesicles with the presynaptic membrane. This gene is a member of the vesicle-asso
• OMIM: 603657

Protein Summary

• Protein general information: Q15836  
  • Name: Vesicle associated membrane protein 3 (VAMP 3) (Cellubrevin) (CEB) (Synaptobrevin 3)
  • Length: 100  
  • Mass: 11309
• Sequence:

  MSTGPTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKN
  CKMWAIGITVLVIFIIIIIVWVVSS

• Structural information:
  • Protein Domains: (14..7-)
    homology (/note="v-SNARE-coiled-coil)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00290"-)
  • Interpro: IPR001388  IPR016444  IPR042855  
  • Prosite: PS00417 PS50892
  • DIP: 56422
  • STRING: ENSP00000054666
• Other Databases: GeneCards:  VAMP3  Malacards:  VAMP3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0031201	SNARE complex	IBA	cellular component
GO:0017075	syntaxin-1 binding	IBA	molecular function
GO:0006906	vesicle fusion	IBA	biological process
GO:0035493	SNARE complex assembly	IBA	biological process
GO:0019905	syntaxin binding	IBA	molecular function
GO:0005886	plasma membrane	IBA	cellular component
GO:0005484	SNAP receptor activity	IBA	molecular function
GO:0042147	retrograde transport, endosome to Golgi	IDA	biological process
GO:0030136	clathrin-coated vesicle	IDA	cellular component
GO:0016192	vesicle-mediated transport	ISS	biological process
GO:0034446	substrate adhesion-dependent cell spreading	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001921	positive regulation of receptor recycling	ISS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0015031	protein transport	IEA	biological process
GO:0045202	synapse	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0065003	protein-containing complex assembly	TAS	biological process
GO:0006887	exocytosis	TAS	biological process
GO:0006904	vesicle docking involved in exocytosis	TAS	biological process
GO:0016021	integral component of membrane	TAS	cellular component
GO:0061025	membrane fusion	TAS	biological process
GO:0055037	recycling endosome	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030133	transport vesicle	TAS	cellular component
GO:0030670	phagocytic vesicle membrane	TAS	cellular component
GO:0002479	antigen processing and presentation of exogenous peptide antigen via MHC class I, TAP-dependent	TAS	biological process
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0030665	clathrin-coated vesicle membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0032588	trans-Golgi network membrane	TAS	cellular component
GO:0055038	recycling endosome membrane	TAS	cellular component
GO:0061024	membrane organization	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0017075	syntaxin-1 binding	IEA	molecular function
GO:0030285	integral component of synaptic vesicle membrane	IEA	cellular component
GO:0030665	clathrin-coated vesicle membrane	IEA	cellular component
GO:0031201	SNARE complex	IEA	cellular component
GO:0043229	intracellular organelle	IEA	cellular component
GO:0043231	intracellular membrane-bounded organelle	IEA	cellular component
GO:0055037	recycling endosome	IEA	cellular component
GO:0097708	intracellular vesicle	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0016192	vesicle-mediated transport	IEA	biological process
GO:0017156	calcium-ion regulated exocytosis	IEA	biological process
GO:0030141	secretory granule	IEA	cellular component
GO:0031410	cytoplasmic vesicle	IEA	cellular component
GO:0048471	perinuclear region of cytoplasm	IEA	cellular component
GO:0071346	cellular response to interferon-gamma	IEA	biological process
GO:0000149	SNARE binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0016324	apical plasma membrane	IEA	cellular component
GO:0065003	protein-containing complex assembly	IEA	biological process
GO:0001921	positive regulation of receptor recycling	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0009986	cell surface	IEA	cellular component
GO:0034446	substrate adhesion-dependent cell spreading	IEA	biological process
GO:0035493	SNARE complex assembly	IEA	biological process
GO:0043001	Golgi to plasma membrane protein transport	IEA	biological process
GO:0045335	phagocytic vesicle	IEA	cellular component
GO:0043005	neuron projection	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0031201	SNARE complex	IDA	cellular component
GO:1903531	negative regulation of secretion by cell	IDA	biological process
GO:0043231	intracellular membrane-bounded organelle	IDA	cellular component
GO:1903593	regulation of histamine secretion by mast cell	IMP	NOT|biological process
GO:0070254	mucus secretion	IMP	NOT|biological process
GO:0051024	positive regulation of immunoglobulin secretion	IMP	NOT|biological process

KEGG pathways

Pathway id	Pathway name
hsa04145	Phagosome
hsa04130	SNARE interactions in vesicular transport

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)