• Gene id: 93380

Gene Summary

• Gene Symbol: MMGT1   Gene   UCSC   Ensembl
• Aliases: EMC5, TMEM32
• Gene name: membrane magnesium transporter 1
• Alternate names: membrane magnesium transporter 1, ER membrane protein complex subunit 5, transmembrane protein 32,
• Gene location: Xq26.3 (135974062: 135960587)     Exons: 4     NC_000023.11

Protein Summary

• Protein general information: Q8N4V1  
  • Name: Membrane magnesium transporter 1 (ER membrane protein complex subunit 5) (Transmembrane protein 32)
  • Length: 131  
  • Mass: 14686
• Sequence:

  MAPSLWKGLVGIGLFALAHAAFSAAQHRSYMRLTEKEDESLPIDIVLQTLLAFAVTCYGIVHIAGEFKDMDATSE
  LKNKTFDTLRNHPSFYVFNHRGRVLFRPSDTANSSNQDALSSNTSLKLRKLESLRR

• Structural information:
  • Interpro: IPR018937  
  • STRING: ENSP00000306220
• Other Databases: GeneCards:  MMGT1  Malacards:  MMGT1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005769	early endosome	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0072546	ER membrane protein complex	IBA	cellular component
GO:0005794	Golgi apparatus	IBA	cellular component
GO:0022890	inorganic cation transmembrane transporter activity	IBA	molecular function
GO:0072546	ER membrane protein complex	IDA	cellular component
GO:0016021	integral component of membrane	IDA	cellular component
GO:0005783	endoplasmic reticulum	IEA	cellular component
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0005768	endosome	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0022890	inorganic cation transmembrane transporter activity	IEA	molecular function
GO:0015693	magnesium ion transport	IEA	biological process
GO:0015087	cobalt ion transmembrane transporter activity	IEA	molecular function
GO:0006826	iron ion transport	IEA	biological process
GO:0006825	copper ion transport	IEA	biological process
GO:0006812	cation transport	IEA	biological process
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0015095	magnesium ion transmembrane transporter activity	IEA	molecular function
GO:0015093	ferrous iron transmembrane transporter activity	IEA	molecular function
GO:0006824	cobalt ion transport	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005769	early endosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005789	endoplasmic reticulum membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0031901	early endosome membrane	IEA	cellular component
GO:1903830	magnesium ion transmembrane transport	IEA	biological process
GO:1903830	magnesium ion transmembrane transport	IEA	biological process
GO:0034755	iron ion transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0098655	cation transmembrane transport	IEA	biological process
GO:0016020	membrane	HDA	cellular component
GO:0005769	early endosome	ISS	cellular component
GO:0015095	magnesium ion transmembrane transporter activity	ISS	molecular function
GO:0015693	magnesium ion transport	ISS	biological process
GO:0005794	Golgi apparatus	ISS	cellular component

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881