• Gene id: 9338

Gene Summary

• Gene Symbol: TCEAL1   Gene   UCSC   Ensembl
• Aliases: SIIR, WEX9, p21, pp21
• Gene name: transcription elongation factor A like 1
• Alternate names: transcription elongation factor A protein-like 1, TCEA-like protein 1, nuclear phosphoprotein p21/SIIR, transcription elongation factor A (SII)-like 1, transcription elongation factor S-II protein-like 1,
• Gene location: Xq22.2 (103628715: 103630952)     Exons: 4     NC_000023.11
• Gene summary(Entrez): This gene encodes a member of the transcription elongation factor A (SII)-like (TCEAL) gene family. Members of this family may function as nuclear phosphoproteins that modulate transcription in a promoter context-dependent manner. The encoded protein is s
• OMIM: 300237

Protein Summary

• Protein general information: Q15170  
  • Name: Transcription elongation factor A protein like 1 (TCEA like protein 1) (Nuclear phosphoprotein p21/SIIR) (Transcription elongation factor S II protein like 1)
  • Length: 157  
  • Mass: 18354
  • Tissue specificity: Expressed in all tissues examined. Highly expressed in heart, ovary, prostate and skeletal muscle. Moderately expressed in brain, placenta, testis and small intestine. Weakly expressed in lung, liver and spleen. Expressed in several ca
• Sequence:

  MDKPRKENEEEPQSRPRPMRRGLRWSTLPKSSPPRSSLRRSSPRRRSSFLRSSCLSSCLRCSSRRTPSAGLSRKD
  LFEGRPPMEQPPCGVGKHKLEEGSFKERLARSRPQFRGDIHGRNLSNEEMIQAADELEEMKRVRNKLMIMHWKAK
  RSRPYPI

• Structural information:
  • Interpro: IPR010370  IPR021156  
• Other Databases: GeneCards:  TCEAL1  Malacards:  TCEAL1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050699	WW domain binding	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0010629	negative regulation of gene expression	TAS	NOT|biological process negative effect

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)