• Gene id: 93377

Gene Summary

• Gene Symbol: OPALIN   Gene   UCSC   Ensembl
• Aliases: HTMP10, TMEM10, TMP10
• Gene name: oligodendrocytic myelin paranodal and inner loop protein
• Alternate names: opalin, transmembrane protein 10, transmembrane protein TMP10,
• Gene location: 10q24.1 (96359364: 96343215)     Exons: 8     NC_000010.11
• OMIM: 608827

Protein Summary

• Protein general information: Q96PE5  
  • Name: Opalin (Oligodendrocytic myelin paranodal and inner loop protein) (Transmembrane protein 10)
  • Length: 141  
  • Mass: 15683
  • Tissue specificity: Brain specific; expressed in oligodendrocytes (PubMed
• Sequence:

  MSFSLNFTLPANTTSSPVTGGKETDCGPSLGLAAGIPLLVATALLVALLFTLIHRRRSSIEAMEESDRPCEISEI
  DDNPKISENPRRSPTHEKNTMGAQEAHIYVKTVAGSEEPVHDRYRPTIEMERRRGLWWLVPRLSLE

• Structural information:
  • Interpro: IPR026609  
  • STRING: ENSP00000360214
• Other Databases: GeneCards:  OPALIN  Malacards:  OPALIN

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0044291	cell-cell contact zone	IBA	cellular component
GO:0005886	plasma membrane	IBA	cellular component
GO:0048713	regulation of oligodendrocyte differentiation	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005794	Golgi apparatus	IDA	cellular component
GO:0048713	regulation of oligodendrocyte differentiation	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0044291	cell-cell contact zone	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq