• Gene id: 9337

Gene Summary

• Gene Symbol: CNOT8   Gene   UCSC   Ensembl
• Aliases: CAF1, CALIF, Caf1b, POP2, hCAF1
• Gene name: CCR4-NOT transcription complex subunit 8
• Alternate names: CCR4-NOT transcription complex subunit 8, CAF1-like protein, CAF2, CALIFp, CCR4-associated factor 8, PGK promoter directed over production,
• Gene location: 5q33.2 (154857951: 154876791)     Exons: 10     NC_000005.10
• OMIM: 603731

Protein Summary

• Protein general information: Q9UFF9  
  • Name: CCR4 NOT transcription complex subunit 8 (EC 3.1.13.4) (CAF1 like protein) (CALIFp) (CAF2) (CCR4 associated factor 8) (Caf1b)
  • Length: 292  
  • Mass: 33540
• Sequence:

  MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKII
  QLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLMTSGVVLCDN
  VKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQH
  QAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ

• Structural information:
  • Interpro: IPR039637  IPR027212  IPR006941  IPR012337  IPR036397  
  • DIP: 29084
  • STRING: ENSP00000430493
• Other Databases: GeneCards:  CNOT8  Malacards:  CNOT8

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000932	P-body	IBA	cellular component
GO:0004535	poly(A)-specific ribonuclease activity	IBA	molecular function
GO:0017148	negative regulation of translation	IBA	biological process
GO:0030015	CCR4-NOT core complex	IBA	cellular component
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	IBA	biological process
GO:0030014	CCR4-NOT complex	IDA	cellular component
GO:0004535	poly(A)-specific ribonuclease activity	IDA	molecular function
GO:0043928	exonucleolytic catabolism of deadenylated mRNA	IDA	biological process
GO:0000175	3'-5'-exoribonuclease activity	IDA	molecular function
GO:0008284	positive regulation of cell population proliferation	IMP	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0035195	gene silencing by miRNA	TAS	biological process
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0030014	CCR4-NOT complex	IEA	cellular component
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0016787	hydrolase activity	IEA	molecular function
GO:0004518	nuclease activity	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0006417	regulation of translation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0004527	exonuclease activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0031047	gene silencing by RNA	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0004535	poly(A)-specific ribonuclease activity	IEA	molecular function
GO:0000289	nuclear-transcribed mRNA poly(A) tail shortening	TAS	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0006977	DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest	TAS	biological process
GO:0005622	intracellular	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0061014	positive regulation of mRNA catabolic process	IMP	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090305	nucleic acid phosphodiester bond hydrolysis	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0090503	RNA phosphodiester bond hydrolysis, exonucleolytic	IEA	biological process
GO:0006355	regulation of transcription, DNA-templated	NAS	biological process
GO:0005634	nucleus	NAS	cellular component
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa03018	RNA degradation

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881