• Gene id: 9329

Gene Summary

• Gene Symbol: GTF3C4   Gene   UCSC   Ensembl
• Aliases: KAT12, TF3C-delta, TFIII90, TFIIIC290, TFIIIC90, TFIIICDELTA
• Gene name: general transcription factor IIIC subunit 4
• Alternate names: general transcription factor 3C polypeptide 4, TFIIIC 90 kDa subunit, general transcription factor 3C 4, general transcription factor IIIC, polypeptide 4, 90kDa, transcription factor IIIC 90 kDa subunit, transcription factor IIIC subunit delta,
• Gene location: 9q34.13 (132670034: 132694954)     Exons: 6     NC_000009.12
• OMIM: 611653

Protein Summary

• Protein general information: Q9UKN8  
  • Name: General transcription factor 3C polypeptide 4 (EC 2.3.1.48) (TF3C delta) (Transcription factor IIIC 90 kDa subunit) (TFIIIC 90 kDa subunit) (TFIIIC90) (Transcription factor IIIC subunit delta)
  • Length: 822  
  • Mass: 91982
• Sequence:

  MNTADQARVGPADDGPAPSGEEEGEGGGEAGGKEPAADAAPGPSAAFRLMVTRREPAVKLQYAVSGLEPLAWSED
  HRVSVSTARSIAVLELICDVHNPGQDLVIHRTSVPAPLNSCLLKVGSKTEVAECKEKFAASKDPTVSQTFMLDRV
  FNPEGKALPPMRGFKYTSWSPMGCDANGRCLLAALTMDNRLTIQANLNRLQWVQLVDLTEIYGERLYETSYRLSK
  NEAPEGNLGDFAEFQRRHSMQTPVRMEWSGICTTQQVKHNNECRDVGSVLLAVLFENGNIAVWQFQLPFVGKESI
  SSCNTIESGITSPSVLFWWEYEHNNRKMSGLIVGSAFGPIKILPVNLKAVKGYFTLRQPVILWKEMDQLPVHSIK
  CVPLYHPYQKCSCSLVVAARGSYVFWCLLLISKAGLNVHNSHVTGLHSLPIVSMTADKQNGTVYTCSSDGKVRQL
  IPIFTDVALKFEHQLIKLSDVFGSVRTHGIAVSPCGAYLAIITTEGMINGLHPVNKNYQVQFVTLKTFEEAAAQL
  LESSVQNLFKQVDLIDLVRWKILKDKHIPQFLQEALEKKIESSGVTYFWRFKLFLLRILYQSMQKTPSEALWKPT
  HEDSKILLVDSPGMGNADDEQQEEGTSSKQVVKQGLQERSKEGDVEEPTDDSLPTTGDAGGREPMEEKLLEIQGK
  IEAVEMHLTREHMKRVLGEVYLHTWITENTSIPTRGLCNFLMSDEEYDDRTARVLIGHISKKMNKQTFPEHCSLC
  KEILPFTDRKQAVCSNGHIWLRCFLTYQSCQSLIYRRCLLHDSIARHPAPEDPDWIKRLLQSPCPFCDSPVF

• Structural information:
  • Interpro: IPR024761  IPR024764  IPR036322  
  • STRING: ENSP00000361219
• Other Databases: GeneCards:  GTF3C4  Malacards:  GTF3C4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006383	transcription by RNA polymerase III	IC	biological process
GO:0003677	DNA binding	IC	contributes to
GO:0042797	tRNA transcription by RNA polymerase III	IC	biological process
GO:0000127	transcription factor TFIIIC complex	IDA	cellular component
GO:0042791	5S class rRNA transcription by RNA polymerase III	IC	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0000127	transcription factor TFIIIC complex	IBA	cellular component
GO:0016746	transferase activity, transferring acyl groups	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008047	enzyme activator activity	TAS	molecular function
GO:0004402	histone acetyltransferase activity	TAS	molecular function
GO:0006384	transcription initiation from RNA polymerase III promoter	TAS	biological process
GO:0004402	histone acetyltransferase activity	IEA	molecular function
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005739	mitochondrion	IDA	cellular component
GO:0043085	positive regulation of catalytic activity	IEA	biological process
GO:0016573	histone acetylation	IEA	biological process
GO:0016573	histone acetylation	IEA	biological process

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray