• Gene id: 93273

Gene Summary

• Gene Symbol: LEMD1   Gene   UCSC   Ensembl
• Aliases: CT50, LEMP-1
• Gene name: LEM domain containing 1
• Alternate names: LEM domain-containing protein 1, LEM domain protein 1, cancer/testis antigen 50,
• Gene location: 1q32.1 (205449955: 205381377)     Exons: 11     NC_000001.11
• OMIM: 618467

Protein Summary

• Protein general information: Q68G75  
  • Name: LEM domain containing protein 1 (Cancer/testis antigen 50) (CT50) (LEM domain protein 1) (LEMP 1)
  • Length: 181  
  • Mass: 20326
  • Tissue specificity: Testis-specific. Isoform 6 is detected in 17 of 18 colon cancer tissues examined. {ECO
• Sequence:

  MVDVKCLSDCKLQNQLEKLGFSPGPILPSTRKLYEKKLVQLLVSPPCAPPVMNGPRELDGAQDSDDSEELNIILQ
  GNIILSTEKSKKLKKWPEASTTKRKAVDTYCLDYKPSKGRRWAARAPSTRITYGTITKERDYCAEDQTIESWREE
  GFPVGLKLAVLGIFIIVVFVYLTVENKSLFG

• Structural information:
  • Protein Domains: (1..4-)
    (/note="LEM-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00313"-)
  • Interpro: IPR011015  IPR003887  
  • Prosite: PS50954
  • STRING: ENSP00000356121
• Other Databases: GeneCards:  LEMD1  Malacards:  LEMD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)