• Gene id: 9324

Gene Summary

• Gene Symbol: HMGN3   Gene   UCSC   Ensembl
• Aliases: PNAS-24, PNAS-25, TRIP7
• Gene name: high mobility group nucleosomal binding domain 3
• Alternate names: high mobility group nucleosome-binding domain-containing protein 3, TR-interacting protein 7, thyroid hormone receptor interacting protein 7,
• Gene location: 6q14.1 (79234681: 79201244)     Exons: 7     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene binds thyroid hormone receptor beta in the presence of thyroid hormone. The encoded protein, a member of the HMGN protein family, is thought to reduce the compactness of the chromatin fiber in nucleosomes, thereby enhancin
• OMIM: 604502

Protein Summary

• Protein general information: Q15651  
  • Name: High mobility group nucleosome binding domain containing protein 3 (Thyroid receptor interacting protein 7) (TR interacting protein 7) (TRIP 7)
  • Length: 99  
  • Mass: 10666
  • Tissue specificity: Expressed in kidney, lung, pancreas, testis, skeletal muscle, heart, thyroid gland, pituitary gland, prostate and uterus. Low expression in liver, spleen, placenta and ovaries. {ECO
• Sequence:

  MPKRKSPENTEGKDGSKVTKQEPTRRSARLSAKPAPPKPEPKPRKTSAKKEPGAKISRGAKGKKEEKQEAGKEGT
  APSENGETKAEEAQKTESVDNEGE

• Structural information:
  • Interpro: IPR031073  IPR000079  
  • Prosite: PS00355
• Other Databases: GeneCards:  HMGN3  Malacards:  HMGN3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003682	chromatin binding	IEA	molecular function
GO:0031492	nucleosomal DNA binding	IEA	molecular function
GO:0000785	chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0061178	regulation of insulin secretion involved in cellular response to glucose stimulus	IEA	biological process
GO:0006325	chromatin organization	IEA	biological process
GO:0003677	DNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0046966	thyroid hormone receptor binding	NAS	molecular function
GO:0008150	biological_process	ND	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881