• Gene id: 9318

Gene Summary

• Gene Symbol: COPS2   Gene   UCSC   Ensembl
• Aliases: ALIEN, CSN2, SGN2, TRIP15
• Gene name: COP9 signalosome subunit 2
• Alternate names: COP9 signalosome complex subunit 2, COP9 constitutive photomorphogenic homolog subunit 2, JAB1-containing signalosome subunit 2, TR-interacting protein 15, TRIP-15, alien homolog, signalosome subunit 2, thyroid receptor-interacting protein 15,
• Gene location: 15q21.1 (49155598: 49122726)     Exons: 13     NC_000015.10
• OMIM: 604508

Protein Summary

• Protein general information: P61201  
  • Name: COP9 signalosome complex subunit 2 (SGN2) (Signalosome subunit 2) (Alien homolog) (JAB1 containing signalosome subunit 2) (Thyroid receptor interacting protein 15) (TR interacting protein 15) (TRIP 15)
  • Length: 443  
  • Mass: 51597
• Sequence:

  MSDMEDDFMCDDEEDYDLEYSEDSNSEPNVDLENQYYNSKALKEDDPKAALSSFQKVLELEGEKGEWGFKALKQM
  IKINFKLTNFPEMMNRYKQLLTYIRSAVTRNYSEKSINSILDYISTSKQMDLLQEFYETTLEALKDAKNDRLWFK
  TNTKLGKLYLEREEYGKLQKILRQLHQSCQTDDGEDDLKKGTQLLEIYALEIQMYTAQKNNKKLKALYEQSLHIK
  SAIPHPLIMGVIRECGGKMHLREGEFEKAHTDFFEAFKNYDESGSPRRTTCLKYLVLANMLMKSGINPFDSQEAK
  PYKNDPEILAMTNLVSAYQNNDITEFEKILKTNHSNIMDDPFIREHIEELLRNIRTQVLIKLIKPYTRIHIPFIS
  KELNIDVADVESLLVQCILDNTIHGRIDQVNQLLELDHQKRGGARYTALDKWTNQLNSLNQAVVSKLA

• Structural information:
  • Protein Domains: (254..41-)
    (/note="PCI-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU01185"-)
  • Interpro: IPR037750  IPR000717  IPR011990  IPR036390  
  • Prosite: PS50250
  • PDB: 4D10 4D18 4WSN 6A73 6R6H 6R7F 6R7H 6R7I 6R7N
  • PDBsum: 4D10 4D18 4WSN 6A73 6R6H 6R7F 6R7H 6R7I 6R7N
  • DIP: 42076
  • STRING: ENSP00000299259
• Other Databases: GeneCards:  COPS2  Malacards:  COPS2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0045892	negative regulation of transcription, DNA-templated	IBA	biological process
GO:0008180	COP9 signalosome	IBA	cellular component
GO:0003714	transcription corepressor activity	IBA	molecular function
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0000338	protein deneddylation	IDA	biological process
GO:1903507	negative regulation of nucleic acid-templated transcription	ISS	biological process
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0006283	transcription-coupled nucleotide-excision repair	TAS	biological process
GO:0000715	nucleotide-excision repair, DNA damage recognition	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0008180	COP9 signalosome	IEA	cellular component
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0030182	neuron differentiation	IEA	biological process
GO:1903507	negative regulation of nucleic acid-templated transcription	IEA	biological process
GO:0001833	inner cell mass cell proliferation	IEA	biological process
GO:0003714	transcription corepressor activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0008283	cell population proliferation	IEA	biological process
GO:0035914	skeletal muscle cell differentiation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0008180	COP9 signalosome	IDA	cellular component
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0007165	signal transduction	NAS	biological process
GO:0006366	transcription by RNA polymerase II	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269
Unexplained infertility	MIK: 25753583

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
25753583	Unexplained infertility			46 (17 fertile men, 29 male patients)	Male infertility	Microarray