• Gene id: 9315

Gene Summary

• Gene Symbol: NREP   Gene   UCSC   Ensembl
• Aliases: C5orf13, D4S114, P311, PRO1873, PTZ17, SEZ17
• Gene name: neuronal regeneration related protein
• Alternate names: neuronal regeneration-related protein, neuronal protein 3.1, neuronal regeneration related protein homolog, protein p311,
• Gene location: 5q22.1 (111976931: 111728801)     Exons: 9     NC_000005.10
• OMIM: 607332

Protein Summary

• Protein general information: Q16612  
  • Name: Neuronal regeneration related protein (Neuronal protein 3.1) (Protein p311)
  • Length: 68  
  • Mass: 7909
  • Tissue specificity: Expressed in lung (at protein level). {ECO
• Sequence:

  MVYYPELFVWVSQEPFPNKDMEGRLPKGRLPVPKEVNRKKNDETNAASLTPLGSSELRSPRISYLHFF

• Structural information:
  • Interpro: IPR024417  
  • STRING: ENSP00000378996
• Other Databases: GeneCards:  NREP  Malacards:  NREP

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0017015	regulation of transforming growth factor beta receptor signaling pathway	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0005737	cytoplasm	IBA	cellular component
GO:0031103	axon regeneration	IBA	biological process
GO:0045664	regulation of neuron differentiation	IBA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005737	cytoplasm	IEA	cellular component

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq