• Gene id: 93145

Gene Summary

• Gene Symbol: OLFM2   Gene   UCSC   Ensembl
• Aliases: NOE2, NOELIN2, NOELIN2_V1, OlfC
• Gene name: olfactomedin 2
• Alternate names: noelin-2, neuronal olfactomedin related ER localized protein 2,
• Gene location: 19p13.2 (9936514: 9853717)     Exons: 8     NC_000019.10
• OMIM: 604890

Protein Summary

• Protein general information: O95897  
  • Name: Noelin 2 (Olfactomedin 2)
  • Length: 454  
  • Mass: 51386
  • Tissue specificity: Expressed in aortic smooth muscle (at protein level) (PubMed
• Sequence:

  MWPLTVPPPLLLLLCSGLAGQTLFQNPEEGWQLYTSAQAPDGKCICTAVIPAQSTCSRDGRSRELRQLMEKVQNV
  SQSMEVLELRTYRDLQYVRGMETLMRSLDARLRAADGSLSAKSFQELKDRMTELLPLSSVLEQYKADTRTIVRLR
  EEVRNLSGSLAAIQEEMGAYGYEDLQQRVMALEARLHACAQKLGCGKLTGVSNPITVRAMGSRFGSWMTDTMAPS
  ADSRVWYMDGYYKGRRVLEFRTLGDFIKGQNFIQHLLPQPWAGTGHVVYNGSLFYNKYQSNVVVKYHFRSRSVLV
  QRSLPGAGYNNTFPYSWGGFSDMDFMVDESGLWAVYTTNQNAGNIVVSRLDPHTLEVMRSWDTGYPKRSAGEAFM
  ICGVLYVTNSHLAGAKVYFAYFTNTSSYEYTDVPFHNQYSHISMLDYNPRERALYTWNNGHQVLYNVTLFHVIST
  SGDP

• Structural information:
  • Protein Domains: (194..44-)
    (/note="Olfactomedin-like-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00446"-)
  • Interpro: IPR031219  IPR022082  IPR003112  
  • Prosite: PS51132
  • STRING: ENSP00000264833
• Other Databases: GeneCards:  OLFM2  Malacards:  OLFM2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:1905174	regulation of vascular smooth muscle cell dedifferentiation	ISS	biological process
GO:0005576	extracellular region	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005576	extracellular region	IDA	cellular component
GO:0009306	protein secretion	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0099243	extrinsic component of synaptic membrane	IEA	cellular component
GO:0098978	glutamatergic synapse	IEA	cellular component
GO:0007626	locomotory behavior	IEA	biological process
GO:0007601	visual perception	IEA	biological process
GO:1905174	regulation of vascular smooth muscle cell dedifferentiation	IEA	biological process
GO:0097060	synaptic membrane	IEA	cellular component
GO:0032281	AMPA glutamate receptor complex	IEA	cellular component
GO:0005576	extracellular region	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0045202	synapse	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0051152	positive regulation of smooth muscle cell differentiation	IMP	biological process
GO:0032281	AMPA glutamate receptor complex	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq