• Gene id: 9314

Gene Summary

• Gene Symbol: KLF4   Gene   UCSC   Ensembl
• Aliases: EZF, GKLF
• Gene name: Kruppel like factor 4
• Alternate names: Krueppel-like factor 4, Kruppel-like factor 4 (gut), endothelial Kruppel-like zinc finger protein, epithelial zinc finger protein EZF, gut Kruppel-like factor, gut-enriched krueppel-like factor,
• Gene location: 9q31.2 (26429259: 26445014)     Exons: 4     NC_000022.11
• Gene summary(Entrez): This gene encodes a protein that belongs to the Kruppel family of transcription factors. The encoded zinc finger protein is required for normal development of the barrier function of skin. The encoded protein is thought to control the G1-to-S transition o
• OMIM: 602253

Protein Summary

• Protein general information: O43474  
  • Name: Krueppel like factor 4 (Epithelial zinc finger protein EZF) (Gut enriched krueppel like factor)
  • Length: 513  
  • Mass: 54671
• Sequence:

  MRQPPGESDMAVSDALLPSFSTFASGPAGREKTLRQAGAPNNRWREELSHMKRLPPVLPGRPYDLAAATVATDLE
  SGGAGAACGGSNLAPLPRRETEEFNDLLDLDFILSNSLTHPPESVAATVSSSASASSSSSPSSSGPASAPSTCSF
  TYPIRAGNDPGVAPGGTGGGLLYGRESAPPPTAPFNLADINDVSPSGGFVAELLRPELDPVYIPPQQPQPPGGGL
  MGKFVLKASLSAPGSEYGSPSVISVSKGSPDGSHPVVVAPYNGGPPRTCPKIKQEAVSSCTHLGAGPPLSNGHRP
  AAHDFPLGRQLPSRTTPTLGLEEVLSSRDCHPALPLPPGFHPHPGPNYPSFLPDQMQPQVPPLHYQGQSRGFVAR
  AGEPCVCWPHFGTHGMMLTPPSSPLELMPPGSCMPEEPKPKRGRRSWPRKRTATHTCDYAGCGKTYTKSSHLKAH
  LRTHTGEKPYHCDWDGCGWKFARSDELTRHYRKHTGHRPFQCQKCDRAFSRSDHLALHMKRHF

• Structural information:
  • Interpro: IPR036236  IPR013087  
  • Prosite: PS00028 PS50157
  • DIP: 57667
  • STRING: ENSP00000363804
• Other Databases: GeneCards:  KLF4  Malacards:  KLF4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0000790	nuclear chromatin	ISA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA	molecular function
GO:0000976	transcription regulatory region sequence-specific DNA binding	IBA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA	molecular function
GO:1990841	promoter-specific chromatin binding	IDA	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	ISS	biological process
GO:0000976	transcription regulatory region sequence-specific DNA binding	ISS	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0045595	regulation of cell differentiation	ISS	biological process
GO:0019827	stem cell population maintenance	ISS	biological process
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	TAS	molecular function
GO:0008285	negative regulation of cell population proliferation	TAS	biological process
GO:0007500	mesodermal cell fate determination	TAS	biological process
GO:0035019	somatic stem cell population maintenance	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001221	transcription cofactor binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0003690	double-stranded DNA binding	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0035014	phosphatidylinositol 3-kinase regulator activity	IEA	molecular function
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045892	negative regulation of transcription, DNA-templated	IEA	biological process
GO:0071409	cellular response to cycloheximide	IEA	biological process
GO:0000978	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IEA	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IEA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA	molecular function
GO:0003700	DNA-binding transcription factor activity	IEA	molecular function
GO:0006357	regulation of transcription by RNA polymerase II	IEA	biological process
GO:0006366	transcription by RNA polymerase II	IEA	biological process
GO:0008013	beta-catenin binding	IEA	molecular function
GO:0008285	negative regulation of cell population proliferation	IEA	biological process
GO:0009913	epidermal cell differentiation	IEA	biological process
GO:0010033	response to organic substance	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0030336	negative regulation of cell migration	IEA	biological process
GO:0042127	regulation of cell population proliferation	IEA	biological process
GO:0043433	negative regulation of DNA-binding transcription factor activity	IEA	biological process
GO:0043565	sequence-specific DNA binding	IEA	molecular function
GO:0045444	fat cell differentiation	IEA	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IEA	biological process
GO:0048730	epidermis morphogenesis	IEA	biological process
GO:0000785	chromatin	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005667	transcription regulator complex	IEA	cellular component
GO:0014067	negative regulation of phosphatidylinositol 3-kinase signaling	IEA	biological process
GO:0014740	negative regulation of muscle hyperplasia	IEA	biological process
GO:0042826	histone deacetylase binding	IEA	molecular function
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048662	negative regulation of smooth muscle cell proliferation	IEA	biological process
GO:0051898	negative regulation of protein kinase B signaling	IEA	biological process
GO:0070301	cellular response to hydrogen peroxide	IEA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IEA	biological process
GO:0071300	cellular response to retinoic acid	IEA	biological process
GO:0071407	cellular response to organic cyclic compound	IEA	biological process
GO:1901653	cellular response to peptide	IEA	biological process
GO:0000981	DNA-binding transcription factor activity, RNA polymerase II-specific	IEA	molecular function
GO:0001010	RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005719	nuclear euchromatin	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0006351	transcription, DNA-templated	IEA	biological process
GO:0008134	transcription factor binding	IEA	molecular function
GO:0019827	stem cell population maintenance	IEA	biological process
GO:0031077	post-embryonic camera-type eye development	IEA	biological process
GO:0032526	response to retinoic acid	IEA	biological process
GO:0045595	regulation of cell differentiation	IEA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IEA	biological process
GO:0048679	regulation of axon regeneration	IEA	biological process
GO:0060070	canonical Wnt signaling pathway	IEA	biological process
GO:1904798	positive regulation of core promoter binding	IEA	biological process
GO:1990830	cellular response to leukemia inhibitory factor	IEA	biological process
GO:0032270	positive regulation of cellular protein metabolic process	IMP	biological process
GO:0071499	cellular response to laminar fluid shear stress	IMP	biological process
GO:0051973	positive regulation of telomerase activity	IDA	biological process
GO:0045429	positive regulation of nitric oxide biosynthetic process	IMP	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:1904998	negative regulation of leukocyte adhesion to arterial endothelial cell	IGI	biological process
GO:0010629	negative regulation of gene expression	IGI	biological process
GO:0045893	positive regulation of transcription, DNA-templated	IDA	biological process
GO:0000987	cis-regulatory region sequence-specific DNA binding	IDA	molecular function
GO:0001228	DNA-binding transcription activator activity, RNA polymerase II-specific	IMP	molecular function
GO:0001085	RNA polymerase II transcription factor binding	ISS	molecular function
GO:0001085	RNA polymerase II transcription factor binding	IPI	molecular function
GO:0001010	RNA polymerase II sequence-specific DNA-binding transcription factor recruiting activity	ISS	molecular function
GO:0071363	cellular response to growth factor stimulus	IDA	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IDA	biological process
GO:2000342	negative regulation of chemokine (C-X-C motif) ligand 2 production	IDA	biological process
GO:1903672	positive regulation of sprouting angiogenesis	IGI	biological process
GO:0000122	negative regulation of transcription by RNA polymerase II	IDA	biological process
GO:0000790	nuclear chromatin	IDA	cellular component
GO:0032088	negative regulation of NF-kappaB transcription factor activity	IDA	biological process
GO:0034115	negative regulation of heterotypic cell-cell adhesion	IDA	biological process
GO:0043154	negative regulation of cysteine-type endopeptidase activity involved in apoptotic process	IDA	biological process
GO:0045415	negative regulation of interleukin-8 biosynthetic process	IDA	biological process
GO:0060761	negative regulation of response to cytokine stimulus	IDA	biological process
GO:0035166	post-embryonic hemopoiesis	IMP	biological process
GO:0045444	fat cell differentiation	ISS	biological process
GO:0046985	positive regulation of hemoglobin biosynthetic process	IMP	biological process
GO:0051247	positive regulation of protein metabolic process	IGI	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IMP	biological process
GO:0016525	negative regulation of angiogenesis	IDA	biological process
GO:2000134	negative regulation of G1/S transition of mitotic cell cycle	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	ISS	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IGI	biological process
GO:0050728	negative regulation of inflammatory response	TAS	biological process
GO:1902895	positive regulation of pri-miRNA transcription by RNA polymerase II	IDA	biological process
GO:0010628	positive regulation of gene expression	IGI	biological process
GO:0010629	negative regulation of gene expression	IGI	biological process
GO:0010629	negative regulation of gene expression	IGI	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0045892	negative regulation of transcription, DNA-templated	IDA	biological process
GO:0008270	zinc ion binding	NAS	molecular function
GO:0045893	positive regulation of transcription, DNA-templated	NAS	biological process
GO:0003700	DNA-binding transcription factor activity	NAS	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04550	Signaling pathways regulating pluripotency of stem cells
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map
P06959	CCKR signaling map

Diseases

Associated diseases	References
Meningioma	KEGG:H01556
Meningioma	KEGG:H01556
hepatocellular carcinoma	PMID:22677193
hepatocellular carcinoma	PMID:22677193
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray