• Gene id: 9308

Gene Summary

• Gene Symbol: CD83   Gene   UCSC   Ensembl
• Aliases: BL11, HB15
• Gene name: CD83 molecule
• Alternate names: CD83 antigen, B-cell activation protein, CD83 antigen (activated B lymphocytes, immunoglobulin superfamily), cell surface protein HB15, cell-surface glycoprotein, hCD83,
• Gene location: 6p23 (14117255: 14136917)     Exons: 6     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene is a single-pass type I membrane protein and member of the immunoglobulin superfamily of receptors. The encoded protein may be involved in the regulation of antigen presentation. A soluble form of this protein can bind to
• OMIM: 604534

Protein Summary

• Protein general information: Q01151  
  • Name: CD83 antigen (hCD83) (B cell activation protein) (Cell surface protein HB15) (CD antigen CD83)
  • Length: 205  
  • Mass: 23042
  • Tissue specificity: Expressed by activated lymphocytes, Langerhans cells and interdigitating reticulum cells.
• Sequence:

  MSRGLQLLLLSCAYSLAPATPEVKVACSEDVDLPCTAPWDPQVPYTVSWVKLLEGGEERMETPQEDHLRGQHYHQ
  KGQNGSFDAPNERPYSLKIRNTTSCNSGTYRCTLQDPDGQRNLSGKVILRVTGCPAQRKEETFKKYRAEIVLLLA
  LVIFYLTLIIFTCKFARLQSIFPDFSKAGMERAFLPVTSPNKHLGLVTPHKTELV

• Structural information:
  • Protein Domains: (20..11-)
    (/note="Ig-like-V-type")
  • Interpro: IPR007110  IPR036179  IPR013783  IPR003599  IPR013106  
  • Prosite: PS50835
  • PDB: 5MIX 5MJ0 5MJ1 5MJ2
  • PDBsum: 5MIX 5MJ0 5MJ1 5MJ2
  • STRING: ENSP00000368450
• Other Databases: GeneCards:  CD83  Malacards:  CD83

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0006952	defense response	TAS	biological process
GO:0006959	humoral immune response	TAS	biological process
GO:0007165	signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0014070	response to organic cyclic compound	IEA	biological process
GO:0032713	negative regulation of interleukin-4 production	IEA	biological process
GO:0032733	positive regulation of interleukin-10 production	IEA	biological process
GO:0032743	positive regulation of interleukin-2 production	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0043372	positive regulation of CD4-positive, alpha-beta T cell differentiation	IEA	biological process
GO:0016020	membrane	IEA	cellular component

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)