• Gene id: 9306

Gene Summary

• Gene Symbol: SOCS6   Gene   UCSC   Ensembl
• Aliases: CIS-4, CIS4, HSPC060, SOCS-4, SOCS-6, SOCS4, SSI4, STAI4, STATI4
• Gene name: suppressor of cytokine signaling 6
• Alternate names: suppressor of cytokine signaling 6, STAT induced STAT inhibitor-4, cytokine-inducible SH2 protein 4, suppressor of cytokine signaling 4,
• Gene location: 18q22.2 (70289044: 70330198)     Exons: 5     NC_000018.10
• Gene summary(Entrez): The protein encoded by this gene contains a SH2 domain and a CIS homolog domain. The protein thus belongs to the cytokine-induced STAT inhibitor (CIS), also known as suppressor of cytokine signaling (SOCS) or STAT-induced STAT inhibitor (SSI), protein fam
• OMIM: 606716

Protein Summary

• Protein general information: O14544  
  • Name: Suppressor of cytokine signaling 6 (SOCS 6) (Cytokine inducible SH2 protein 4) (CIS 4) (Suppressor of cytokine signaling 4) (SOCS 4)
  • Length: 535  
  • Mass: 59528
• Sequence:

  MKKISLKTLRKSFNLNKSKEETDFMVVQQPSLASDFGKDDSLFGSCYGKDMASCDINGEDEKGGKNRSKSESLMG
  TLKRRLSAKQKSKGKAGTPSGSSADEDTFSSSSAPIVFKDVRAQRPIRSTSLRSHHYSPAPWPLRPTNSEETCIK
  MEVRVKALVHSSSPSPALNGVRKDFHDLQSETTCQEQANSLKSSASHNGDLHLHLDEHVPVVIGLMPQDYIQYTV
  PLDEGMYPLEGSRSYCLDSSSPMEVSAVPPQVGGRAFPEDESQVDQDLVVAPEIFVDQSVNGLLIGTTGVMLQSP
  RAGHDDVPPLSPLLPPMQNNQIQRNFSGLTGTEAHVAESMRCHLNFDPNSAPGVARVYDSVQSSGPMVVTSLTEE
  LKKLAKQGWYWGPITRWEAEGKLANVPDGSFLVRDSSDDRYLLSLSFRSHGKTLHTRIEHSNGRFSFYEQPDVEG
  HTSIVDLIEHSIRDSENGAFCYSRSRLPGSATYPVRLTNPVSRFMQVRSLQYLCRFVIRQYTRIDLIQKLPLPNK
  MKDYLQEKHY

• Structural information:
  • Protein Domains: (384..49-)
    (/note="SH2-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00191-)
    (486..53-)
    (/note="SOCS-box)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00194"-)
  • Interpro: IPR000980  IPR036860  IPR028421  IPR035865  IPR037345   IPR001496  IPR036036  
  • Prosite: PS50001 PS50225
  • CDD: cd10387 cd03740
  • PDB: 2VIF
  • PDBsum: 2VIF
  • STRING: ENSP00000381034
• Other Databases: GeneCards:  SOCS6  Malacards:  SOCS6

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IBA	molecular function
GO:0005942	phosphatidylinositol 3-kinase complex	IBA	cellular component
GO:0046854	phosphatidylinositol phosphorylation	IBA	biological process
GO:0005942	phosphatidylinositol 3-kinase complex	IEA	cellular component
GO:0046935	1-phosphatidylinositol-3-kinase regulator activity	IEA	molecular function
GO:0016567	protein ubiquitination	IEA	biological process
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0046854	phosphatidylinositol phosphorylation	IEA	biological process
GO:0009968	negative regulation of signal transduction	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0006952	defense response	TAS	biological process
GO:0007259	receptor signaling pathway via JAK-STAT	TAS	biological process
GO:0005737	cytoplasm	TAS	cellular component
GO:0001772	immunological synapse	IDA	cellular component
GO:0010498	proteasomal protein catabolic process	IMP	biological process
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0043687	post-translational protein modification	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050868	negative regulation of T cell activation	IEA	biological process
GO:0040008	regulation of growth	IEA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0043551	regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0016567	protein ubiquitination	IEA	biological process

KEGG pathways

Pathway id	Pathway name
hsa04630	JAK-STAT signaling pathway
hsa04917	Prolactin signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881