• Gene id: 930

Gene Summary

• Gene Symbol: CD19   Gene   UCSC   Ensembl
• Aliases: B4, CVID3
• Gene name: CD19 molecule
• Alternate names: B-lymphocyte antigen CD19, B-lymphocyte surface antigen B4, T-cell surface antigen Leu-12, differentiation antigen CD19,
• Gene location: 16p11.2 (28931734: 28939346)     Exons: 15     NC_000016.10
• Gene summary(Entrez): Lymphocytes proliferate and differentiate in response to various concentrations of different antigens. The ability of the B cell to respond in a specific, yet sensitive manner to the various antigens is achieved with the use of low-affinity antigen recept
• OMIM: 611741

Protein Summary

• Protein general information: P15391  
  • Name: B lymphocyte antigen CD19 (B lymphocyte surface antigen B4) (Differentiation antigen CD19) (T cell surface antigen Leu 12) (CD antigen CD19)
  • Length: 556  
  • Mass: 61128
  • Tissue specificity: Detected on marginal zone and germinal center B cells in lymph nodes (PubMed
• Sequence:

  MPPPRLLFFLLFLTPMEVRPEEPLVVKVEEGDNAVLQCLKGTSDGPTQQLTWSRESPLKPFLKLSLGLPGLGIHM
  RPLAIWLFIFNVSQQMGGFYLCQPGPPSEKAWQPGWTVNVEGSGELFRWNVSDLGGLGCGLKNRSSEGPSSPSGK
  LMSPKLYVWAKDRPEIWEGEPPCLPPRDSLNQSLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVHPKGPKSL
  LSLELKDDRPARDMWVMETGLLLPRATAQDAGKYYCHRGNLTMSFHLEITARPVLWHWLLRTGGWKVSAVTLAYL
  IFCLCSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSGLGRAQRWAAGLGGTA
  PSYGNPSSDVQADGALGSRSPPGVGPEEEEGEGYEEPDSEEDSEFYENDSNLGQDQLSQDGSGYENPEDEPLGPE
  DEDSFSNAESYENEDEELTQPVARTMDFLSPHGSAWDPSREATSLGSQSYEDMRGILYAAPQLRSIRGQPGPNHE
  EDADSYENMDNPDGPDPAWGGGGRMGTWSTR

• Structural information:
  • Protein Domains: (20..11-)
    1 (/note="Ig-like-C2-type)
    (176..27-)
    2" (/note="Ig-like-C2-type)
  • Interpro: IPR042341  IPR007110  IPR036179  IPR013783  IPR003599  
  • Prosite: PS50835
  • PDB: 6AL5
  • PDBsum: 6AL5
  • STRING: ENSP00000437940
• Other Databases: GeneCards:  CD19  Malacards:  CD19

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0050853	B cell receptor signaling pathway	IBA	biological process
GO:0009897	external side of plasma membrane	IBA	cellular component
GO:0050851	antigen receptor-mediated signaling pathway	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IDA	biological process
GO:0002322	B cell proliferation involved in immune response	IDA	biological process
GO:0050864	regulation of B cell activation	IDA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IMP	biological process
GO:0050855	regulation of B cell receptor signaling pathway	IMP	biological process
GO:0050853	B cell receptor signaling pathway	ISS	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IMP	biological process
GO:0002322	B cell proliferation involved in immune response	IMP	biological process
GO:0016064	immunoglobulin mediated immune response	IMP	biological process
GO:0002322	B cell proliferation involved in immune response	IEA	biological process
GO:0050864	regulation of B cell activation	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0002250	adaptive immune response	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0032991	protein-containing complex	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0009897	external side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0051897	positive regulation of protein kinase B signaling	TAS	biological process
GO:0030449	regulation of complement activation	TAS	biological process
GO:0050776	regulation of immune response	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0050855	regulation of B cell receptor signaling pathway	IEA	biological process
GO:0050853	B cell receptor signaling pathway	IEA	biological process
GO:0043552	positive regulation of phosphatidylinositol 3-kinase activity	IEA	biological process
GO:0019724	B cell mediated immunity	IEA	biological process
GO:0001923	B-1 B cell differentiation	IEA	biological process
GO:0051281	positive regulation of release of sequestered calcium ion into cytosol	IEA	biological process
GO:0009897	external side of plasma membrane	IEA	cellular component
GO:0005887	integral component of plasma membrane	IEA	cellular component
GO:0045121	membrane raft	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0070062	extracellular exosome	HDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04151	PI3K-Akt signaling pathway
hsa05169	Epstein-Barr virus infection
hsa04662	B cell receptor signaling pathway
hsa04640	Hematopoietic cell lineage
hsa05340	Primary immunodeficiency

Diseases

Associated diseases	References
Common variable immunodeficiency	KEGG:H00088
Common variable immunodeficiency	KEGG:H00088
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq