• Gene id: 92979

Gene Summary

• Gene Symbol: MARCHF9   Gene   UCSC   Ensembl
• Aliases: MARCH-IX, MARCH9, RNF179
• Gene name: membrane associated ring-CH-type finger 9
• Alternate names: E3 ubiquitin-protein ligase MARCHF9, E3 ubiquitin-protein ligase MARCH9, RING finger protein 179, RING-type E3 ubiquitin transferase MARCH9, RING-type E3 ubiquitin transferase MARCHF9, membrane associated ring finger 9, membrane-associated RING finger protein 9,
• Gene location: 12q14.1 (57755102: 57760410)     Exons: 4     NC_000012.12
• Gene summary(Entrez): MARCH9 is a member of the MARCH family of membrane-bound E3 ubiquitin ligases (EC 6.3.2.19). MARCH enzymes add ubiquitin (see MIM 191339) to target lysines in substrate proteins, thereby signaling their vesicular transport between membrane compartments. M
• OMIM: 606079

Protein Summary

• Protein general information: Q86YJ5  
  • Name: E3 ubiquitin protein ligase MARCHF9 (EC 2.3.2.27) (Membrane associated RING finger protein 9) (Membrane associated RING CH protein IX) (MARCH IX) (RING finger protein 179) (RING type E3 ubiquitin transferase MARCHF9)
  • Length: 346  
  • Mass: 37772
  • Tissue specificity: Ubiquitously expressed. {ECO
• Sequence:

  MLKSRLRMFLNELKLLVLTGGGRPRAEPQPRGGRGGGCGWAPFAGCSTRDGDGDEEEYYGSEPRARGLAGDKEPR
  AGPLPPPAPPLPPPGALDALSLSSSLDSGLRTPQCRICFQGPEQGELLSPCRCDGSVRCTHQPCLIRWISERGSW
  SCELCYFKYQVLAISTKNPLQWQAISLTVIEKVQIAAIVLGSLFLVASISWLIWSSLSPSAKWQRQDLLFQICYG
  MYGFMDVVCIGLIIHEGSSVYRIFKRWQAVNQQWKVLNYDKTKDIGGDAGGGTAGKSGPRNSRTGPTSGATSRPP
  AAQRMRTLLPQRCGYTILHLLGQLRPPDARSSSHSGREVVMRVTTV

• Structural information:
  • Interpro: IPR011016  IPR013083  
  • Prosite: PS51292
  • STRING: ENSP00000266643
• Other Databases: GeneCards:  MARCHF9  Malacards:  MARCHF9

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008270	zinc ion binding	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0005764	lysosome	IEA	cellular component
GO:0046872	metal ion binding	IEA	molecular function
GO:0005794	Golgi apparatus	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005765	lysosomal membrane	IEA	cellular component
GO:0000139	Golgi membrane	IEA	cellular component
GO:0016567	protein ubiquitination	IEA	biological process
GO:0005802	trans-Golgi network	IDA	cellular component
GO:0005795	Golgi stack	IDA	cellular component

Diseases

Associated diseases	References
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R