• Gene id: 92960

Gene Summary

• Gene Symbol: PEX11G   Gene   UCSC   Ensembl
• Gene name: peroxisomal biogenesis factor 11 gamma
• Alternate names: peroxisomal membrane protein 11C, PEX11-gamma, Pex11pgamma, peroxin Pex11p gamma, peroxin-11C, peroxisomal biogenesis factor 11C, peroxisomal biogenesis factor 11G, protein PEX11 homolog gamma,
• Gene location: 19p13.2 (7494976: 7476874)     Exons: 12     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the PEX11 family. This family is reported to regulate the number and size of peroxisomes in evolutionarily distant organisms. The protein encoded by this gene may induce clustering of peroxisomes. Alternativ
• OMIM: 607583

Protein Summary

• Protein general information: Q96HA9  
  • Name: Peroxisomal membrane protein 11C (Peroxin 11C) (Peroxisomal biogenesis factor 11C) (Protein PEX11 homolog gamma) (PEX11 gamma)
  • Length: 241  
  • Mass: 26636
• Sequence:

  MASLSGLASALESYRGRDRLIRVLGYCCQLVGGVLVEQCPARSEVGTRLLVVSTQLSHCRTILRLFDDLAMFVYT
  KQYGLGAQEEDAFVRCVSVLGNLADQLYYPCEHVAWAADARVLHVDSSRWWTLSTTLWALSLLLGVARSLWMLLK
  LRQRLRSPTAPFTSPLPRGKRRAMEAQMQSEALSLLSNLADLANAVHWLPRGVLWAGRFPPWLVGLMGTISSILS
  MYQAARAGGQAEATTP

• Structural information:
  • Interpro: IPR008733  IPR026510  
  • STRING: ENSP00000221480
• Other Databases: GeneCards:  PEX11G  Malacards:  PEX11G

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0016559	peroxisome fission	IEA	biological process
GO:0005779	integral component of peroxisomal membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005777	peroxisome	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005778	peroxisomal membrane	IEA	cellular component
GO:0005777	peroxisome	IDA	cellular component
GO:0044375	regulation of peroxisome size	IDA	biological process
GO:0032991	protein-containing complex	IDA	cellular component
GO:0031231	intrinsic component of peroxisomal membrane	IDA	cellular component
GO:0016559	peroxisome fission	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04146	Peroxisome

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq