• Gene id: 92906

Gene Summary

• Gene Symbol: HNRNPLL   Gene   UCSC   Ensembl
• Aliases: HNRPLL, SRRF
• Gene name: heterogeneous nuclear ribonucleoprotein L like
• Alternate names: heterogeneous nuclear ribonucleoprotein L-like, stromal RNA regulating factor,
• Gene location: 2p22.1 (38603035: 38561968)     Exons: 16     NC_000002.12
• Gene summary(Entrez): HNRNPLL is a master regulator of activation-induced alternative splicing in T cells. In particular, it alters splicing of CD45 (PTPRC; MIM 151460), a tyrosine phosphatase essential for T-cell development and activation (Oberdoerffer et al., 2008 [PubMed 1
• OMIM: 611208

Protein Summary

• Protein general information: Q8WVV9  
  • Name: Heterogeneous nuclear ribonucleoprotein L like (hnRNPLL) (Stromal RNA regulating factor)
  • Length: 542  
  • Mass: 60083
  • Tissue specificity: Widely expressed. Detected in bone marrow stroma cells, skeletal muscle, heart, placenta, pancreas, kidney and lung. {ECO
• Sequence:

  MSSSSSSPRETYEEDREYESQAKRLKTEEGEIDYSAEEGENRREATPRGGGDGGGGGRSFSQPEAGGSHHKVSVS
  PVVHVRGLCESVVEADLVEALEKFGTICYVMMMPFKRQALVEFENIDSAKECVTFAADEPVYIAGQQAFFNYSTS
  KRITRPGNTDDPSGGNKVLLLSIQNPLYPITVDVLYTVCNPVGKVQRIVIFKRNGIQAMVEFESVLCAQKAKAAL
  NGADIYAGCCTLKIEYARPTRLNVIRNDNDSWDYTKPYLGRRDRGKGRQRQAILGEHPSSFRHDGYGSHGPLLPL
  PSRYRMGSRDTPELVAYPLPQASSSYMHGGNPSGSVVMVSGLHQLKMNCSRVFNLFCLYGNIEKVKFMKTIPGTA
  LVEMGDEYAVERAVTHLNNVKLFGKRLNVCVSKQHSVVPSQIFELEDGTSSYKDFAMSKNNRFTSAGQASKNIIQ
  PPSCVLHYYNVPLCVTEETFTKLCNDHEVLTFIKYKVFDAKPSAKTLSGLLEWECKTDAVEALTALNHYQIRVPN
  GSNPYTLKLCFSTSSHL

• Structural information:
  • Protein Domains: (76..15-)
    (/note="RRM-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (166..24-)
    (/note="RRM-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176-)
    (335..40-)
    (/note="RRM-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00176"-)
  • Interpro: IPR006536  IPR034985  IPR034986  IPR034983  IPR034987   IPR012677  IPR021790  IPR035979  IPR000504  
  • Prosite: PS50102
  • CDD: cd12781 cd12786 cd12700 cd12705
  • STRING: ENSP00000390625
• Other Databases: GeneCards:  HNRNPLL  Malacards:  HNRNPLL

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0003729	mRNA binding	IBA	molecular function
GO:0006417	regulation of translation	IBA	biological process
GO:0033120	positive regulation of RNA splicing	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0043484	regulation of RNA splicing	IBA	biological process
GO:0033120	positive regulation of RNA splicing	IDA	biological process
GO:0003729	mRNA binding	IDA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0003676	nucleic acid binding	IEA	molecular function
GO:0003723	RNA binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0006397	mRNA processing	IEA	biological process
GO:0003723	RNA binding	IEA	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0016020	membrane	HDA	cellular component
GO:0003723	RNA binding	HDA	molecular function
GO:0003723	RNA binding	HDA	molecular function

Diseases

Associated diseases	References
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray