• Gene id: 9290

Gene Summary

• Gene Symbol: GPR55   Gene   UCSC   Ensembl
• Aliases: LPIR1
• Gene name: G protein-coupled receptor 55
• Alternate names: G-protein coupled receptor 55,
• Gene location: 2q37.1 (230961269: 230907317)     Exons: 4     NC_000002.12
• Gene summary(Entrez): This gene belongs to the G-protein-coupled receptor superfamily. The encoded integral membrane protein is a likely cannabinoid receptor. It may be involved in several physiological and pathological processes by activating a variety of signal transduction

Protein Summary

• Protein general information: Q9Y2T6  
  • Name: G protein coupled receptor 55
  • Length: 319  
  • Mass: 36637
  • Tissue specificity: Expressed in the caudate nucleus and putamen, but not detected in the hippocampus, thalamus, pons cerebellum, frontal cortex of the brain or in the liver. Expressed in osteoclasts and osteoblasts. {ECO
• Sequence:

  MSQQNTSGDCLFDGVNELMKTLQFAVHIPTFVLGLLLNLLAIHGFSTFLKNRWPDYAATSIYMINLAVFDLLLVL
  SLPFKMVLSQVQSPFPSLCTLVECLYFVSMYGSVFTICFISMDRFLAIRYPLLVSHLRSPRKIFGICCTIWVLVW
  TGSIPIYSFHGKVEKYMCFHNMSDDTWSAKVFFPLEVFGFLLPMGIMGFCCSRSIHILLGRRDHTQDWVQQKACI
  YSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIR
  AHRPSRVQLVLQDTTISRG

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR028334  
  • Prosite: PS00237 PS50262
  • STRING: ENSP00000375894
• Other Databases: GeneCards:  GPR55  Malacards:  GPR55

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007202	activation of phospholipase C activity	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IBA	molecular function
GO:0004949	cannabinoid receptor activity	IBA	molecular function
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0035025	positive regulation of Rho protein signal transduction	IBA	biological process
GO:0051482	positive regulation of cytosolic calcium ion concentration involved in phospholipase C-activating G protein-coupled signaling pathway	IBA	biological process
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	TAS	molecular function
GO:0005887	integral component of plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0038171	cannabinoid signaling pathway	IEA	biological process
GO:0038171	cannabinoid signaling pathway	IEA	biological process
GO:0007202	activation of phospholipase C activity	IDA	biological process
GO:0070374	positive regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	IDA	biological process
GO:0045671	negative regulation of osteoclast differentiation	IDA	biological process
GO:0045453	bone resorption	IDA	biological process
GO:0035025	positive regulation of Rho protein signal transduction	IDA	biological process
GO:0005887	integral component of plasma membrane	IDA	cellular component
GO:0004949	cannabinoid receptor activity	IDA	molecular function

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881