• Gene id: 92856

Gene Summary

• Gene Symbol: IMP4   Gene   UCSC   Ensembl
• Aliases: BXDC4
• Gene name: IMP U3 small nucleolar ribonucleoprotein 4
• Alternate names: U3 small nucleolar ribonucleoprotein protein IMP4, IMP4 homolog, U3 small nucleolar ribonucleoprotein, IMP4, U3 small nucleolar ribonucleoprotein, homolog, U3 snoRNP protein 4 homolog, U3 snoRNP protein IMP4, brix domain-containing protein 4,
• Gene location: 2q21.1 (3456573: 3268972)     Exons: 20     NC_000006.12
• Gene summary(Entrez): The protein encoded by this gene, along with IMP3 and MPP10, is part of the 60-80S U3 small nucleolar ribonucleoprotein (U3 snoRNP) complex. This complex is necessary for the early cleavage steps of pre-18S ribosomal RNA processing. Several transcript var
• OMIM: 612981

Protein Summary

• Protein general information: Q96G21  
  • Name: U3 small nucleolar ribonucleoprotein protein IMP4 (U3 snoRNP protein IMP4) (Brix domain containing protein 4)
  • Length: 291  
  • Mass: 33757
• Sequence:

  MLRREARLRREYLYRKAREEAQRSAQERKERLRRALEENRLIPTELRREALALQGSLEFDDAGGEGVTSHVDDEY
  RWAGVEDPKVMITTSRDPSSRLKMFAKELKLVFPGAQRMNRGRHEVGALVRACKANGVTDLLVVHEHRGTPVGLI
  VSHLPFGPTAYFTLCNVVMRHDIPDLGTMSEAKPHLITHGFSSRLGKRVSDILRYLFPVPKDDSHRVITFANQDD
  YISFRHHVYKKTDHRNVELTEVGPRFELKLYMIRLGTLEQEATADVEWRWHPYTNTARKRVFLSTE

• Structural information:
  • Protein Domains: (83..26-)
    (/note="Brix-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00034"-)
  • Interpro: IPR007109  
  • Prosite: PS50833
  • STRING: ENSP00000259239
• Other Databases: GeneCards:  IMP4  Malacards:  IMP4

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006364	rRNA processing	NAS	biological process
GO:0005730	nucleolus	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0006364	rRNA processing	IBA	biological process
GO:0032040	small-subunit processome	IBA	cellular component
GO:0034457	Mpp10 complex	IBA	cellular component
GO:0005730	nucleolus	IBA	cellular component
GO:0030515	snoRNA binding	IBA	molecular function
GO:0042254	ribosome biogenesis	IEA	biological process
GO:0006364	rRNA processing	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0030684	preribosome	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component
GO:0034457	Mpp10 complex	IDA	cellular component
GO:0006364	rRNA processing	TAS	biological process
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005654	nucleoplasm	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005730	nucleolus	IEA	cellular component
GO:0001650	fibrillar center	IDA	cellular component
GO:0005730	nucleolus	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa03008	Ribosome biogenesis in eukaryotes

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881