• Gene id: 9283

Gene Summary

• Gene Symbol: GPR37L1   Gene   UCSC   Ensembl
• Aliases: ET(B)R-LP-2, ETBR-LP-2, ETBRLP2
• Gene name: G protein-coupled receptor 37 like 1
• Alternate names: G-protein coupled receptor 37-like 1, endothelin B receptor-like protein 2, endothelin type b receptor-like protein 2, prosaposin receptor GPR37L1,
• Gene location: 1q32.1 (54968784: 54951897)     Exons: 6     NC_000017.11
• OMIM: 617630

Protein Summary

• Protein general information: O60883  
  • Name: G protein coupled receptor 37 like 1 (Endothelin B receptor like protein 2) (ETBR LP 2)
  • Length: 481  
  • Mass: 52771
  • Tissue specificity: Expressed in primary cortical astrocytes (at protein level) (PubMed
• Sequence:

  MRWLWPLAVSLAVILAVGLSRVSGGAPLHLGRHRAETQEQQSRSKRGTEDEEAKGVQQYVPEEWAEYPRPIHPAG
  LQPTKPLVATSPNPGKDGGTPDSGQELRGNLTGAPGQRLQIQNPLYPVTESSYSAYAIMLLALVVFAVGIVGNLS
  VMCIVWHSYYLKSAWNSILASLALWDFLVLFFCLPIVIFNEITKQRLLGDVSCRAVPFMEVSSLGVTTFSLCALG
  IDRFHVATSTLPKVRPIERCQSILAKLAVIWVGSMTLAVPELLLWQLAQEPAPTMGTLDSCIMKPSASLPESLYS
  LVMTYQNARMWWYFGCYFCLPILFTVTCQLVTWRVRGPPGRKSECRASKHEQCESQLNSTVVGLTVVYAFCTLPE
  NVCNIVVAYLSTELTRQTLDLLGLINQFSTFFKGAITPVLLLCICRPLGQAFLDCCCCCCCEECGGASEASAANG
  SDNKLKTEVSSSIYFHKPRESPPLLPLGTPC

• Structural information:
  • Interpro: IPR000276  IPR017452  IPR003909  
  • Prosite: PS50262
  • STRING: ENSP00000356251
• Other Databases: GeneCards:  GPR37L1  Malacards:  GPR37L1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0008528	G protein-coupled peptide receptor activity	IDA	molecular function
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IDA	biological process
GO:0036505	prosaposin receptor activity	IDA	molecular function
GO:0043410	positive regulation of MAPK cascade	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0042277	peptide binding	IPI	molecular function
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	ISS	biological process
GO:0005886	plasma membrane	IBA	cellular component
GO:0007193	adenylate cyclase-inhibiting G protein-coupled receptor signaling pathway	IBA	biological process
GO:0008528	G protein-coupled peptide receptor activity	IBA	molecular function
GO:0043410	positive regulation of MAPK cascade	IBA	biological process
GO:0043235	receptor complex	IBA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007165	signal transduction	IEA	biological process
GO:0042995	cell projection	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0004930	G protein-coupled receptor activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0043235	receptor complex	IDA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0007186	G protein-coupled receptor signaling pathway	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0048712	negative regulation of astrocyte differentiation	IEA	biological process
GO:0021940	positive regulation of cerebellar granule cell precursor proliferation	IEA	biological process
GO:0003085	negative regulation of systemic arterial blood pressure	IEA	biological process
GO:1903206	negative regulation of hydrogen peroxide-induced cell death	IEA	biological process
GO:0045879	negative regulation of smoothened signaling pathway	IEA	biological process
GO:0045665	negative regulation of neuron differentiation	IEA	biological process
GO:0043410	positive regulation of MAPK cascade	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0060170	ciliary membrane	IEA	cellular component
GO:0036505	prosaposin receptor activity	IDA	NOT|molecular function
GO:0004930	G protein-coupled receptor activity	IDA	molecular function
GO:0036505	prosaposin receptor activity	IDA	NOT|molecular function
GO:0005886	plasma membrane	IDA	cellular component
GO:0016021	integral component of membrane	NAS	cellular component
GO:0003085	negative regulation of systemic arterial blood pressure	ISS	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)