• Gene id: 92745

Gene Summary

• Gene Symbol: SLC38A5   Gene   UCSC   Ensembl
• Aliases: JM24, SN2, SNAT5, pp7194
• Gene name: solute carrier family 38 member 5
• Alternate names: sodium-coupled neutral amino acid transporter 5, solute carrier family 38 (amino acid transporter), member 5, system N transporter 2, transport system N, protein 2,
• Gene location: Xp11.23 (48470259: 48458543)     Exons: 20     NC_000023.11
• Gene summary(Entrez): The protein encoded by this gene is a system N sodium-coupled amino acid transporter. The encoded protein transports glutamine, asparagine, histidine, serine, alanine, and glycine across the cell membrane, but does not transport charged amino acids, imino
• OMIM: 609198

Protein Summary

• Protein general information: Q8WUX1  
  • Name: Sodium coupled neutral amino acid transporter 5 (Solute carrier family 38 member 5) (System N transporter 2)
  • Length: 472  
  • Mass: 51457
  • Tissue specificity: Predominantly expressed in stomach, brain, liver, lung and intestinal tract. {ECO
• Sequence:

  MELQDPKMNGALPSDAVGYRQEREGFLPSRGPAPGSKPVQFMDFEGKTSFGMSVFNLSNAIMGSGILGLAYAMAH
  TGVIFFLALLLCIALLSSYSIHLLLTCAGIAGIRAYEQLGQRAFGPAGKVVVATVICLHNVGAMSSYLFIIKSEL
  PLVIGTFLYMDPEGDWFLKGNLLIIIVSVLIILPLALMKHLGYLGYTSGLSLTCMLFFLVSVIYKKFQLGCAIGH
  NETAMESEALVGLPSQGLNSSCEAQMFTVDSQMSYTVPIMAFAFVCHPEVLPIYTELCRPSKRRMQAVANVSIGA
  MFCMYGLTATFGYLTFYSSVKAEMLHMYSQKDPLILCVRLAVLLAVTLTVPVVLFPIRRALQQLLFPGKAFSWPR
  HVAIALILLVLVNVLVICVPTIRDIFGVIGSTSAPSLIFILPSIFYLRIVPSEVEPFLSWPKIQALCFGVLGVLF
  MAVSLGFMFANWATGQSRMSGH

• Structural information:
  • Interpro: IPR013057  
  • STRING: ENSP00000471683
• Other Databases: GeneCards:  SLC38A5  Malacards:  SLC38A5

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005290	L-histidine transmembrane transporter activity	IMP	molecular function
GO:0005290	L-histidine transmembrane transporter activity	ISS	molecular function
GO:0022889	serine transmembrane transporter activity	IMP	molecular function
GO:0015186	L-glutamine transmembrane transporter activity	IMP	molecular function
GO:0015186	L-glutamine transmembrane transporter activity	ISS	molecular function
GO:0015182	L-asparagine transmembrane transporter activity	IMP	molecular function
GO:0015187	glycine transmembrane transporter activity	IMP	molecular function
GO:0015194	L-serine transmembrane transporter activity	ISS	molecular function
GO:0022858	alanine transmembrane transporter activity	IMP	molecular function
GO:1904557	L-alanine transmembrane transport	IMP	biological process
GO:0006868	glutamine transport	IMP	biological process
GO:0006868	glutamine transport	ISS	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:1903713	asparagine transmembrane transport	IMP	biological process
GO:0150104	transport across blood-brain barrier	NAS	biological process
GO:0015816	glycine transport	IMP	biological process
GO:0089709	L-histidine transmembrane transport	IMP	biological process
GO:0089709	L-histidine transmembrane transport	ISS	biological process
GO:0015825	L-serine transport	ISS	biological process
GO:0032329	serine transport	IMP	biological process
GO:0089709	L-histidine transmembrane transport	IBA	biological process
GO:0015816	glycine transport	IBA	biological process
GO:0015186	L-glutamine transmembrane transporter activity	IBA	molecular function
GO:0032329	serine transport	IBA	biological process
GO:0015187	glycine transmembrane transporter activity	IBA	molecular function
GO:0015171	amino acid transmembrane transporter activity	IBA	molecular function
GO:0006868	glutamine transport	IBA	biological process
GO:0005887	integral component of plasma membrane	IBA	cellular component
GO:0003333	amino acid transmembrane transport	IBA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005886	plasma membrane	TAS	cellular component
GO:0015171	amino acid transmembrane transporter activity	TAS	molecular function
GO:0006865	amino acid transport	TAS	biological process
GO:0005886	plasma membrane	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04727	GABAergic synapse

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Spermatogenic defects	MIK: 31037746

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R