• Gene id: 9274

Gene Summary

• Gene Symbol: BCL7C   Gene   UCSC   Ensembl
• Gene name: BAF chromatin remodeling complex subunit BCL7C
• Alternate names: B-cell CLL/lymphoma 7 protein family member C, B-cell CLL/lymphoma 7C, BCL tumor suppressor 7C, BCL7C, BAF complex component,
• Gene location: 16p11.2 (31959042: 31952086)     Exons: 11     NC_000006.12
• Gene summary(Entrez): This gene is identified by the similarity of its product to the N-terminal region of BCL7A protein. The BCL7A protein is encoded by the gene known to be directly involved in a three-way gene translocation in a Burkitt lymphoma cell line. The function of t
• OMIM: 605847

Protein Summary

• Protein general information: Q8WUZ0  
  • Name: B cell CLL/lymphoma 7 protein family member C
  • Length: 217  
  • Mass: 23468
  • Tissue specificity: Ubiquitous. {ECO
• Sequence:

  MAGRTVRAETRSRAKDDIKKVMATIEKVRRWEKRWVTVGDTSLRIFKWVPVVDPQEEERRRAGGGAERSRGRERR
  GRGASPRGGGPLILLDLNDENSNQSFHSEGSLQKGTEPSPGGTPQPSRPVSPAGPPEGVPEEAQPPRLGQERDPG
  GITAGSTDEPPMLTKEEPVPELLEAEAPEAYPVFEPVPPVPEAAQGDTEDSEGAPPLKRICPNAPDP

• Structural information:
  • Interpro: IPR006804  
  • STRING: ENSP00000369674
• Other Databases: GeneCards:  BCL7C  Malacards:  BCL7C

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0006915	apoptotic process	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Cryptorchidism	MIK: 28606200
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			13 (5 controls, 8 cases)	Male infertility	GSE6967 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq