• Gene id: 92737

Gene Summary

• Gene Symbol: DNER   Gene   UCSC   Ensembl
• Aliases: UNQ26, bet
• Gene name: delta/notch like EGF repeat containing
• Alternate names: delta and Notch-like epidermal growth factor-related receptor, H_NH0150O02.1, WUGSC:H_NH0150O02.1, delta-notch-like EGF repeat-containing transmembrane,
• Gene location: 2q36.3 (229714554: 229357628)     Exons: 13     NC_000002.12
• OMIM: 607041

Protein Summary

• Protein general information: Q8NFT8  
  • Name: Delta and Notch like epidermal growth factor related receptor
  • Length: 737  
  • Mass: 78475
  • Tissue specificity: Expressed in brain, spinal cord and adrenal gland. {ECO
• Sequence:

  MQPRRAQAPGAQLLPALALLLLLLGAGPRGSSLANPVPAAPLSAPGPCAAQPCRNGGVCTSRPEPDPQHPAPAGE
  PGYSCTCPAGISGANCQLVADPCASNPCHHGNCSSSSSSSSDGYLCICNEGYEGPNCEQALPSLPATGWTESMAP
  RQLQPVPATQEPDKILPRSQATVTLPTWQPKTGQKVVEMKWDQVEVIPDIACGNASSNSSAGGRLVSFEVPQNTS
  VKIRQDATASLILLWKVTATGFQQCSLIDGRSVTPLQASGGLVLLEEMLALGNNHFIGFVNDSVTKSIVALRLTL
  VVKVSTCVPGESHANDLECSGKGKCTTKPSEATFSCTCEEQYVGTFCEEYDACQRKPCQNNASCIDANEKQDGSN
  FTCVCLPGYTGELCQSKIDYCILDPCRNGATCISSLSGFTCQCPEGYFGSACEEKVDPCASSPCQNNGTCYVDGV
  HFTCNCSPGFTGPTCAQLIDFCALSPCAHGTCRSVGTSYKCLCDPGYHGLYCEEEYNECLSAPCLNAATCRDLVN
  GYECVCLAEYKGTHCELYKDPCANVSCLNGATCDSDGLNGTCICAPGFTGEECDIDINECDSNPCHHGGSCLDQP
  NGYNCHCPHGWVGANCEIHLQWKSGHMAESLTNMPRHSLYIIIGALCVAFILMLIILIVGICRISRIEYQGSSRP
  AYEEFYNCRSIDSEFSNAIASIRHARFGKKSRPAMYDVSPIAYEDYSPDDKPLVTLIKTKDL

• Structural information:
  • Protein Domains: (44..9-)
    (/note="EGF-like-1)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (94..13-)
    (/note="EGF-like-2)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00076-)
    (309..34-)
    (/note="EGF-like-3)
    (/evidence="ECO:0000255|PROSITE-ProRule:PR-)
  • Interpro: IPR001881  IPR013032  IPR000742  IPR000152  IPR018097   IPR009030  
  • Prosite: PS00010 PS00022 PS01186 PS50026 PS01187
  • DIP: 46249
  • STRING: ENSP00000345229
• Other Databases: GeneCards:  DNER  Malacards:  DNER

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005112	Notch binding	IBA	molecular function
GO:0005509	calcium ion binding	IEA	molecular function
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0016021	integral component of membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0048741	skeletal muscle fiber development	IEA	biological process
GO:0030425	dendrite	IEA	cellular component
GO:0005112	Notch binding	IEA	molecular function
GO:0043025	neuronal cell body	IEA	cellular component
GO:0010001	glial cell differentiation	IEA	biological process
GO:0007220	Notch receptor processing	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005769	early endosome	IDA	cellular component
GO:0030425	dendrite	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005509	calcium ion binding	NAS	molecular function
GO:0030276	clathrin binding	TAS	molecular function
GO:0007416	synapse assembly	NAS	biological process
GO:0006897	endocytosis	NAS	biological process
GO:0004888	transmembrane signaling receptor activity	TAS	molecular function
GO:0007417	central nervous system development	IEP	biological process
GO:0001764	neuron migration	NAS	biological process

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq