• Gene id: 9270

Gene Summary

• Gene Symbol: ITGB1BP1   Gene   UCSC   Ensembl
• Aliases: ICAP-1A, ICAP-1B, ICAP-1alpha, ICAP1, ICAP1A, ICAP1B
• Gene name: integrin subunit beta 1 binding protein 1
• Alternate names: integrin beta-1-binding protein 1, bodenin, integrin cytoplasmic domain-associated protein 1, integrin cytoplasmic domain-associated protein 1-alpha, integrin cytoplasmic domain-associated protein 1-beta,
• Gene location: 2p25.1 (9423568: 9403474)     Exons: 53     NC_000002.12
• Gene summary(Entrez): The cytoplasmic domains of integrins are essential for cell adhesion. The protein encoded by this gene binds to the beta1 integrin cytoplasmic domain. The interaction between this protein and beta1 integrin is highly specific. Two isoforms of this protein
• OMIM: 607153

Protein Summary

• Protein general information: O14713  
  • Name: Integrin beta 1 binding protein 1 (Integrin cytoplasmic domain associated protein 1) (ICAP 1)
  • Length: 200  
  • Mass: 21782
  • Tissue specificity: Expressed in endothelial cells and fibroblasts (at protein level). Ubiquitously expressed. Expressed in intestine, colon, testis, ovary, thymus, spleen and prostate. {ECO
• Sequence:

  MFRKGKKRHSSSSSQSSEISTKSKSVDSSLGGLSRSSTVASLDTDSTKSSGQSNNNSDTCAEFRIKYVGAIEKLK
  LSEGKGLEGPLDLINYIDVAQQDGKLPFVPPEEEFIMGVSKYGIKVSTSDQYDVLHRHALYLIIRMVCYDDGLGA
  GKSLLALKTTDASNEEYSLWVYQCNSLEQAQAICKVLSTAFDSVLTSEKP

• Structural information:
  • Protein Domains: (58..20-)
    (/note="PID"-)
  • Interpro: IPR019517  IPR011993  IPR006020  
  • PDB: 1K11 4DX8 4DX9 4JIF
  • PDBsum: 1K11 4DX8 4DX9 4JIF
  • STRING: ENSP00000353850
• Other Databases: GeneCards:  ITGB1BP1  Malacards:  ITGB1BP1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0007160	cell-matrix adhesion	IDA	biological process
GO:0016020	membrane	NAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0001726	ruffle	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0016477	cell migration	TAS	biological process
GO:0030027	lamellipodium	IDA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0001525	angiogenesis	IEA	biological process
GO:0031214	biomineral tissue development	IEA	biological process
GO:0007219	Notch signaling pathway	IEA	biological process
GO:0030154	cell differentiation	IEA	biological process
GO:0051781	positive regulation of cell division	IEA	biological process
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0007155	cell adhesion	IEA	biological process
GO:0035556	intracellular signal transduction	TAS	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0001726	ruffle	IEA	cellular component
GO:0010764	negative regulation of fibroblast migration	IEA	biological process
GO:0051496	positive regulation of stress fiber assembly	IEA	biological process
GO:0051895	negative regulation of focal adhesion assembly	IEA	biological process
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IEA	biological process
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0006933	negative regulation of cell adhesion involved in substrate-bound cell migration	IEA	biological process
GO:0019900	kinase binding	IEA	molecular function
GO:0019901	protein kinase binding	IEA	molecular function
GO:0030027	lamellipodium	IEA	cellular component
GO:0033622	integrin activation	IEA	biological process
GO:0033628	regulation of cell adhesion mediated by integrin	IEA	biological process
GO:0043113	receptor clustering	IEA	biological process
GO:0051451	myoblast migration	IEA	biological process
GO:0051894	positive regulation of focal adhesion assembly	IEA	biological process
GO:0090314	positive regulation of protein targeting to membrane	IEA	biological process
GO:2001044	regulation of integrin-mediated signaling pathway	IEA	biological process
GO:0001726	ruffle	IEA	cellular component
GO:0005856	cytoskeleton	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0030027	lamellipodium	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:1900025	negative regulation of substrate adhesion-dependent cell spreading	IDA	biological process
GO:0090051	negative regulation of cell migration involved in sprouting angiogenesis	IDA	biological process
GO:0071944	cell periphery	IDA	cellular component
GO:0051895	negative regulation of focal adhesion assembly	IDA	biological process
GO:0097746	regulation of blood vessel diameter	IDA	biological process
GO:0048471	perinuclear region of cytoplasm	IDA	cellular component
GO:0045747	positive regulation of Notch signaling pathway	IDA	biological process
GO:0044344	cellular response to fibroblast growth factor stimulus	IDA	biological process
GO:0035148	tube formation	IDA	biological process
GO:0032091	negative regulation of protein binding	IDA	biological process
GO:0010595	positive regulation of endothelial cell migration	IDA	biological process
GO:0008285	negative regulation of cell population proliferation	IDA	biological process
GO:0008284	positive regulation of cell population proliferation	IDA	biological process
GO:0007229	integrin-mediated signaling pathway	IDA	biological process
GO:0007229	integrin-mediated signaling pathway	IDA	biological process
GO:0002043	blood vessel endothelial cell proliferation involved in sprouting angiogenesis	IDA	biological process
GO:0090315	negative regulation of protein targeting to membrane	IDA	biological process
GO:0070373	negative regulation of ERK1 and ERK2 cascade	IDA	biological process
GO:0051897	positive regulation of protein kinase B signaling	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0045944	positive regulation of transcription by RNA polymerase II	IDA	biological process
GO:0043087	regulation of GTPase activity	IDA	biological process
GO:0035924	cellular response to vascular endothelial growth factor stimulus	IDA	biological process
GO:0032148	activation of protein kinase B activity	IDA	biological process
GO:0006469	negative regulation of protein kinase activity	IDA	biological process
GO:0005925	focal adhesion	IDA	NOT|cellular component
GO:0005925	focal adhesion	IDA	NOT|cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005634	nucleus	IDA	cellular component
GO:0005178	integrin binding	IDA	molecular function
GO:0005092	GDP-dissociation inhibitor activity	IDA	molecular function
GO:0051496	positive regulation of stress fiber assembly	ISS	biological process
GO:0010764	negative regulation of fibroblast migration	ISS	biological process
GO:2001044	regulation of integrin-mediated signaling pathway	ISS	biological process
GO:0090314	positive regulation of protein targeting to membrane	ISS	biological process
GO:0051451	myoblast migration	ISS	biological process
GO:0043113	receptor clustering	ISS	biological process
GO:0033628	regulation of cell adhesion mediated by integrin	ISS	biological process
GO:0033622	integrin activation	ISS	biological process
GO:0006933	negative regulation of cell adhesion involved in substrate-bound cell migration	ISS	biological process
GO:0005886	plasma membrane	ISS	cellular component
GO:0005856	cytoskeleton	ISS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005178	integrin binding	IPI	molecular function
GO:0005654	nucleoplasm	IDA	cellular component
GO:0016604	nuclear body	IDA	cellular component
GO:0034451	centriolar satellite	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component
GO:0072659	protein localization to plasma membrane	IDA	biological process

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)