• Gene id: 92675

Gene Summary

• Gene Symbol: DTD1   Gene   UCSC   Ensembl
• Aliases: C20orf88, DTD, DUE-B, DUEB, HARS2, pqn-68
• Gene name: D-aminoacyl-tRNA deacylase 1
• Alternate names: D-aminoacyl-tRNA deacylase 1, D-tyrosyl-tRNA deacylase 1 homolog, D-tyrosyl-tRNA(Tyr) deacylase 1, DNA-unwinding element-binding protein B, gly-tRNA(Ala) deacylase, histidyl-tRNA synthase-related, histidyl-tRNA synthetase 2,
• Gene location: 20p11.23 (65147341: 65232144)     Exons: 8     NC_000001.11
• Gene summary(Entrez): The protein encoded by this gene is similar in sequence to histidyl-tRNA synthetase, which hydrolyzes D-tyrosyl-tRNA(Tyr) into D-tyrosine and free tRNA(Tyr). The encoded protein binds the DNA unwinding element and plays a role in the initiation of DNA rep
• OMIM: 610996

Protein Summary

• Protein general information: Q8TEA8  
  • Name: D aminoacyl tRNA deacylase 1 (DTD) (EC 3.1.1.96) (DNA unwinding element binding protein B) (DUE B) (Gly tRNA(Ala) deacylase) (Histidyl tRNA synthase related)
  • Length: 209  
  • Mass: 23424
  • Tissue specificity: Expressed in many adult and fetal tissues. Highest levels in testis, ovary, spleen and in adult and fetal brain. {ECO
• Sequence:

  MKAVVQRVTRASVTVGGEQISAIGRGICVLLGISLEDTQKELEHMVRKILNLRVFEDESGKHWSKSVMDKQYEIL
  CVSQFTLQCVLKGNKPDFHLAMPTEQAEGFYNSFLEQLRKTYRPELIKDGKFGAYMQVHIQNDGPVTIELESPAP
  GTATSDPKQLSKLEKQQQRKEKTRAKGPSESSKERNTPRKEDRSASSGAEGDVSSEREP

• Structural information:
  • Interpro: IPR003732  IPR023509  
  • CDD: cd00563
  • PDB: 2OKV
  • PDBsum: 2OKV
  • STRING: ENSP00000366672
• Other Databases: GeneCards:  DTD1  Malacards:  DTD1

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002161	aminoacyl-tRNA editing activity	IBA	molecular function
GO:0006399	tRNA metabolic process	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0051500	D-tyrosyl-tRNA(Tyr) deacylase activity	IBA	molecular function
GO:0002161	aminoacyl-tRNA editing activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0051499	D-aminoacyl-tRNA deacylase activity	IEA	molecular function
GO:0016787	hydrolase activity	IEA	molecular function
GO:0006260	DNA replication	IEA	biological process
GO:0000049	tRNA binding	IEA	molecular function
GO:0046872	metal ion binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0003723	RNA binding	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0003677	DNA binding	IEA	molecular function
GO:0051499	D-aminoacyl-tRNA deacylase activity	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0106074	aminoacyl-tRNA metabolism involved in translational fidelity	IEA	biological process
GO:0106074	aminoacyl-tRNA metabolism involved in translational fidelity	IEA	biological process
GO:0106074	aminoacyl-tRNA metabolism involved in translational fidelity	IEA	biological process
GO:0106074	aminoacyl-tRNA metabolism involved in translational fidelity	IEA	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881