• Gene id: 9266

Gene Summary

• Gene Symbol: CYTH2   Gene   UCSC   Ensembl
• Aliases: ARNO, CTS18, CTS18.1, PSCD2, PSCD2L, SEC7L, Sec7p-L, Sec7p-like, cytohesin-2
• Gene name: cytohesin 2
• Alternate names: cytohesin-2, ARF exchange factor, ARF nucleotide-binding site opener, CTC-273B12.8, PH, SEC7 and coiled-coil domain-containing protein 2, pleckstrin homology, Sec7 and coiled-coil domains 2, pleckstrin homology, Sec7 and coiled/coil domains 2 (cytohesin-2),
• Gene location: 19q13.33 (48469207: 48482313)     Exons: 13     NC_000019.10
• Gene summary(Entrez): The protein encoded by this gene is a member of the PSCD family. Members of this family have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckstrin homology (PH) domain. The c
• OMIM: 613297

Protein Summary

• Protein general information: Q99418  
  • Name: Cytohesin 2 (ARF exchange factor) (ARF nucleotide binding site opener) (Protein ARNO) (PH, SEC7 and coiled coil domain containing protein 2)
  • Length: 400  
  • Mass: 46546
  • Tissue specificity: Widely expressed. {ECO
• Sequence:

  MEDGVYEPPDLTPEERMELENIRRRKQELLVEIQRLREELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKFNMD
  PKKGIQFLVENELLQNTPEEIARFLYKGEGLNKTAIGDYLGEREELNLAVLHAFVDLHEFTDLNLVQALRQFLWS
  FRLPGEAQKIDRMMEAFAQRYCLCNPGVFQSTDTCYVLSFAVIMLNTSLHNPNVRDKPGLERFVAMNRGINEGGD
  LPEELLRNLYDSIRNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYTTDKEP
  RGIIPLENLSIREVDDPRKPNCFELYIPNNKGQLIKACKTEADGRVVEGNHMVYRISAPTQEEKDEWIKSIQAAV
  SVDPFYEMLAARKKRISVKKKQEQP

• Structural information:
  • Protein Domains: (72..20-)
    (/note="SEC7-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00189-)
    (259..37-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR011993  IPR001849  IPR023394  IPR000904  IPR035999  
  • Prosite: PS50003 PS50190
  • CDD: cd00171
  • PDB: 1PBV 1R8M 1R8Q 1R8S 1S9D 4JMI 4JMO 4JWL 4JXH 4L5M 4Z21
  • PDBsum: 1PBV 1R8M 1R8Q 1R8S 1S9D 4JMI 4JMO 4JWL 4JXH 4L5M 4Z21
  • DIP: 31598
  • STRING: ENSP00000408236
• Other Databases: GeneCards:  CYTH2  Malacards:  CYTH2

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005886	plasma membrane	IDA	cellular component
GO:0005737	cytoplasm	IDA	cellular component
GO:0070679	inositol 1,4,5 trisphosphate binding	ISS	molecular function
GO:0005086	ARF guanyl-nucleotide exchange factor activity	ISS	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005086	ARF guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0032012	regulation of ARF protein signal transduction	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0005737	cytoplasm	IEA	cellular component
GO:0016020	membrane	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005086	ARF guanyl-nucleotide exchange factor activity	TAS	molecular function
GO:0005886	plasma membrane	TAS	cellular component
GO:0006897	endocytosis	TAS	biological process
GO:0016020	membrane	TAS	cellular component
GO:0030036	actin cytoskeleton organization	TAS	biological process
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0042995	cell projection	IEA	cellular component
GO:0030426	growth cone	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04072	Phospholipase D signaling pathway

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881