• Gene id: 9265

Gene Summary

• Gene Symbol: CYTH3   Gene   UCSC   Ensembl
• Aliases: ARNO3, GRP1, PSCD3, cytohesin-3
• Gene name: cytohesin 3
• Alternate names: cytohesin-3, ARF nucleotide-binding site opener 3, PH, SEC7 and coiled-coil domain-containing protein 3, general receptor of phosphoinositides 1, pleckstrin homology, Sec7 and coiled-coil domains 3,
• Gene location: 7p22.1 (6272623: 6161778)     Exons: 15     NC_000007.14
• Gene summary(Entrez): This gene encodes a member of the PSCD (pleckstrin homology, Sec7 and coiled-coil domains) family. PSCD family members have identical structural organization that consists of an N-terminal coiled-coil motif, a central Sec7 domain, and a C-terminal pleckst
• OMIM: 605081

Protein Summary

• Protein general information: O43739  
  • Name: Cytohesin 3 (ARF nucleotide binding site opener 3) (Protein ARNO3) (General receptor of phosphoinositides 1) (Grp1) (PH, SEC7 and coiled coil domain containing protein 3)
  • Length: 400  
  • Mass: 46349
  • Tissue specificity: Almost absent from liver, thymus and peripheral blood lymphocytes.
• Sequence:

  MDEDGGGEGGGVPEDLSLEEREELLDIRRRKKELIDDIERLKYEIAEVMTEIDNLTSVEESKTTQRNKQIAMGRK
  KFNMDPKKGIQFLIENDLLQSSPEDVAQFLYKGEGLNKTVIGDYLGERDEFNIKVLQAFVELHEFADLNLVQALR
  QFLWSFRLPGEAQKIDRMMEAFASRYCLCNPGVFQSTDTCYVLSFAIIMLNTSLHNHNVRDKPTAERFIAMNRGI
  NEGGDLPEELLRNLYESIKNEPFKIPEDDGNDLTHTFFNPDREGWLLKLGGGRVKTWKRRWFILTDNCLYYFEYT
  TDKEPRGIIPLENLSIREVEDPRKPNCFELYNPSHKGQVIKACKTEADGRVVEGNHVVYRISAPSPEEKEEWMKS
  IKASISRDPFYDMLATRKRRIANKK

• Structural information:
  • Protein Domains: (77..20-)
    (/note="SEC7-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00189-)
    (264..38-)
    (/note="PH-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00145"-)
  • Interpro: IPR011993  IPR001849  IPR023394  IPR000904  IPR035999  
  • Prosite: PS50003 PS50190
  • CDD: cd00171
  • PDB: 4KAX 6U3E 6U3G
  • PDBsum: 4KAX 6U3E 6U3G
  • DIP: 60444
  • STRING: ENSP00000297044
• Other Databases: GeneCards:  CYTH3  Malacards:  CYTH3

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0005829	cytosol	IDA	cellular component
GO:0005086	ARF guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0005086	ARF guanyl-nucleotide exchange factor activity	IDA	molecular function
GO:0031234	extrinsic component of cytoplasmic side of plasma membrane	IDA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IDA	molecular function
GO:0090162	establishment of epithelial cell polarity	ISS	biological process
GO:0005923	bicellular tight junction	ISS	cellular component
GO:0005912	adherens junction	ISS	cellular component
GO:0048193	Golgi vesicle transport	IMP	biological process
GO:0005086	ARF guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0032012	regulation of ARF protein signal transduction	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0030054	cell junction	IEA	cellular component
GO:0008289	lipid binding	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005085	guanyl-nucleotide exchange factor activity	IEA	molecular function
GO:0000139	Golgi membrane	TAS	cellular component
GO:0000139	Golgi membrane	TAS	cellular component
GO:0005829	cytosol	TAS	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0045785	positive regulation of cell adhesion	IEA	biological process
GO:0005886	plasma membrane	IEA	cellular component
GO:0005737	cytoplasm	IEA	cellular component
GO:0005547	phosphatidylinositol-3,4,5-trisphosphate binding	IEA	molecular function
GO:0090162	establishment of epithelial cell polarity	IEA	biological process
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0001726	ruffle	IEA	cellular component
GO:0005923	bicellular tight junction	IEA	cellular component
GO:0005829	cytosol	IEA	cellular component
GO:0005912	adherens junction	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005654	nucleoplasm	IDA	cellular component
GO:0005829	cytosol	IDA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa04144	Endocytosis
hsa05132	Salmonella infection
hsa05130	Pathogenic Escherichia coli infection
hsa04072	Phospholipase D signaling pathway

Diseases

Associated diseases	References
Cryptorchidism	MIK: 28606200
Hypospermatogenesis	MIK: 28361989
Spermatogenic defects	MIK: 31037746
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28606200	Cryptorchidism			Monozgotic twins (1 control, I cwith cryptorchidism)	Male infertility	MeDIP-Seq
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray
31037746	Spermatogenic defects			28 men with azoospermia	Male infertility	Microarray
31037746	Spermatogenic defects			16 (1 control, 15 cases)	Male infertility	GSE6023 analyzed using GEO2R