• Gene id: 9263

Gene Summary

• Gene Symbol: STK17A   Gene   UCSC   Ensembl
• Aliases: DRAK1
• Gene name: serine/threonine kinase 17a
• Alternate names: serine/threonine-protein kinase 17A, DAP kinase-related apoptosis-inducing protein kinase 1, death-associated protein kinase-related 1, serine/threonine kinase 17a (apoptosis-inducing),
• Gene location: 7p13 (43583107: 43627378)     Exons: 8     NC_000007.14
• Gene summary(Entrez): This gene is a member of the DAP kinase-related apoptosis-inducing protein kinase family and encodes an autophosphorylated nuclear protein with a protein kinase domain. The protein has apoptosis-inducing activity. [provided by RefSeq, Jul 2008]
• OMIM: 604726

Protein Summary

• Protein general information: Q9UEE5  
  • Name: Serine/threonine protein kinase 17A (EC 2.7.11.1) (DAP kinase related apoptosis inducing protein kinase 1)
  • Length: 414  
  • Mass: 46558
  • Tissue specificity: Highly expressed in placenta. Lower levels in heart, lung, skeletal muscle, kidney and pancreas. {ECO
• Sequence:

  MIPLEKPGSGGSSPGATSGSGRAGRGLSGPCRPPPPPQARGLLTEIRAVVRTEPFQDGYSLCPGRELGRGKFAVV
  RKCIKKDSGKEFAAKFMRKRRKGQDCRMEIIHEIAVLELAQDNPWVINLHEVYETASEMILVLEYAAGGEIFDQC
  VADREEAFKEKDVQRLMRQILEGVHFLHTRDVVHLDLKPQNILLTSESPLGDIKIVDFGLSRILKNSEELREIMG
  TPEYVAPEILSYDPISMATDMWSIGVLTYVMLTGISPFLGNDKQETFLNISQMNLSYSEEEFDVLSESAVDFIRT
  LLVKKPEDRATAEECLKHPWLTQSSIQEPSFRMEKALEEANALQEGHSVPEINSDTDKSETKESIVTEELIVVTS
  YTLGQCRQSEKEKMEQKAISKRFKFEEPLLQEIPGEFIY

• Structural information:
  • Protein Domains: (61..32-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR042704  IPR011009  IPR000719  IPR017441  IPR008271  
  • Prosite: PS00107 PS50011 PS00108
  • CDD: cd14197
  • STRING: ENSP00000319192
• Other Databases: GeneCards:  STK17A  Malacards:  STK17A

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0005634	nucleus	IBA	cellular component
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:2000377	regulation of reactive oxygen species metabolic process	IMP	biological process
GO:0043065	positive regulation of apoptotic process	IMP	biological process
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016740	transferase activity	IEA	molecular function
GO:0016301	kinase activity	IEA	molecular function
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0000166	nucleotide binding	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0005886	plasma membrane	IDA	cellular component
GO:0016607	nuclear speck	IDA	cellular component
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005634	nucleus	IDA	cellular component
GO:2000271	positive regulation of fibroblast apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881