• Gene id: 9262

Gene Summary

• Gene Symbol: STK17B   Gene   UCSC   Ensembl
• Aliases: DRAK2
• Gene name: serine/threonine kinase 17b
• Alternate names: serine/threonine-protein kinase 17B, DAP kinase-related apoptosis-inducing protein kinase 2, death-associated protein kinase-related 2,
• Gene location: 2q32.3 (10034986: 10058302)     Exons: 12     NC_000020.11
• OMIM: 604727

Protein Summary

• Protein general information: O94768  
  • Name: Serine/threonine protein kinase 17B (EC 2.7.11.1) (DAP kinase related apoptosis inducing protein kinase 2)
  • Length: 372  
  • Mass: 42344
  • Tissue specificity: Highly expressed in placenta, lung, pancreas. Lower levels in heart, brain, liver, skeletal muscle and kidney. {ECO
• Sequence:

  MSRRRFDCRSISGLLTTTPQIPIKMENFNNFYILTSKELGRGKFAVVRQCISKSTGQEYAAKFLKKRRRGQDCRA
  EILHEIAVLELAKSCPRVINLHEVYENTSEIILILEYAAGGEIFSLCLPELAEMVSENDVIRLIKQILEGVYYLH
  QNNIVHLDLKPQNILLSSIYPLGDIKIVDFGMSRKIGHACELREIMGTPEYLAPEILNYDPITTATDMWNIGIIA
  YMLLTHTSPFVGEDNQETYLNISQVNVDYSEETFSSVSQLATDFIQSLLVKNPEKRPTAEICLSHSWLQQWDFEN
  LFHPEETSSSSQTQDHSVRSSEDKTSKSSCNGTCGDREDKENIPEDSSMVSKRFRFDDSLPNPHELVSDLLC

• Structural information:
  • Protein Domains: (33..29-)
    (/note="Protein-kinase)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00159"-)
  • Interpro: IPR011009  IPR000719  IPR017441  IPR008271  IPR042763  
  • Prosite: PS00107 PS50011 PS00108
  • CDD: cd14198
  • PDB: 3LM0 3LM5 6QF4
  • PDBsum: 3LM0 3LM5 6QF4
  • STRING: ENSP00000263955
• Other Databases: GeneCards:  STK17B  Malacards:  STK17B

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0004674	protein serine/threonine kinase activity	IBA	molecular function
GO:0005634	nucleus	IBA	cellular component
GO:0035556	intracellular signal transduction	IBA	biological process
GO:0043065	positive regulation of apoptotic process	IBA	biological process
GO:0046777	protein autophosphorylation	ISS	biological process
GO:0004672	protein kinase activity	ISS	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0005524	ATP binding	IEA	molecular function
GO:0006468	protein phosphorylation	IEA	biological process
GO:0016301	kinase activity	IEA	molecular function
GO:0016740	transferase activity	IEA	molecular function
GO:0016020	membrane	IEA	cellular component
GO:0000166	nucleotide binding	IEA	molecular function
GO:0005634	nucleus	IEA	cellular component
GO:0016310	phosphorylation	IEA	biological process
GO:0005524	ATP binding	IEA	molecular function
GO:0005886	plasma membrane	IEA	cellular component
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0006915	apoptotic process	IEA	biological process
GO:0046777	protein autophosphorylation	IEA	biological process
GO:0015629	actin cytoskeleton	IEA	cellular component
GO:0035556	intracellular signal transduction	IEA	biological process
GO:0012501	programmed cell death	IEA	biological process
GO:0006915	apoptotic process	IEA	biological process
GO:0006468	protein phosphorylation	IEA	biological process
GO:0005634	nucleus	IEA	cellular component
GO:0005524	ATP binding	IEA	molecular function
GO:0004674	protein serine/threonine kinase activity	IEA	molecular function
GO:0004672	protein kinase activity	IEA	molecular function
GO:0005793	endoplasmic reticulum-Golgi intermediate compartment	IEA	cellular component
GO:0005886	plasma membrane	IEA	cellular component
GO:0005634	nucleus	IEA	cellular component
GO:0035556	intracellular signal transduction	IDA	biological process
GO:0006468	protein phosphorylation	IDA	biological process
GO:0005524	ATP binding	IDA	molecular function
GO:0005634	nucleus	IDA	cellular component
GO:0004674	protein serine/threonine kinase activity	IDA	molecular function
GO:2000271	positive regulation of fibroblast apoptotic process	IMP	biological process

Diseases

Associated diseases	References
Aberrant CpGs in Low Motility Sperm	MIK: 21674046
Hypospermatogenesis	MIK: 28361989
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)
21674046	Aberrant CpGs in Low Motility Sperm			18	Male infertility	GSE26881
28361989	Hypospermatogenesis			6 (3 controls, 3 Klienfelter syndrome	Male infertility	Microarray