• Gene id: 92610

Gene Summary

• Gene Symbol: TIFA   Gene   UCSC   Ensembl
• Aliases: T2BP, T6BP, TIFAA
• Gene name: TRAF interacting protein with forkhead associated domain
• Alternate names: TRAF-interacting protein with FHA domain-containing protein A, TRAF-interacting protein with a forkhead-associated domain, TRAF2 binding protein, TRAF6 binding protein, putative MAPK-activating protein PM14, putative NF-kappa-B-activating protein 20,
• Gene location: 4q25 (112285903: 112274536)     Exons: 2     NC_000004.12
• Gene summary(Entrez): This gene encodes an adapter protein involved in adaptive and innate immunity. This protein includes a forkhead-associated (FHA) domain that specifically binds to phosphorylated serine and threonine residues. In response to bacterial infection, the encode
• OMIM: 609028

Protein Summary

• Protein general information: Q96CG3  
  • Name: TRAF interacting protein with FHA domain containing protein A (Putative MAPK activating protein PM14) (Putative NF kappa B activating protein 20) (TRAF2 binding protein)
  • Length: 184  
  • Mass: 21445
• Sequence:

  MTSFEDADTEETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLF
  KKFNSSVLSFEIKNMSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLLQ
  ENNWPPHRPIPEYGTYSLCSSQSSSPTEMDENES

• Structural information:
  • Protein Domains: (47..10-)
    (/note="FHA-)
    (/evidence="ECO:0000255|PROSITE-ProRule:PRU00086"-)
  • Interpro: IPR000253  IPR008984  IPR033621  
  • Prosite: PS50006
  • CDD: cd00060
  • PDB: 4YM4 4ZGI 5ZUJ 6A33
  • PDBsum: 4YM4 4ZGI 5ZUJ 6A33
  • DIP: 40185
  • STRING: ENSP00000354911
• Other Databases: GeneCards:  TIFA  Malacards:  TIFA

Gene ontology

GO accession	Term name	Evidence code	Go category
GO:0002753	cytoplasmic pattern recognition receptor signaling pathway	IBA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0045087	innate immune response	IBA	biological process
GO:0005737	cytoplasm	IBA	cellular component
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IBA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0002753	cytoplasmic pattern recognition receptor signaling pathway	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0002753	cytoplasmic pattern recognition receptor signaling pathway	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0002753	cytoplasmic pattern recognition receptor signaling pathway	IDA	biological process
GO:0043123	positive regulation of I-kappaB kinase/NF-kappaB signaling	IDA	biological process
GO:0045087	innate immune response	IDA	biological process
GO:0002753	cytoplasmic pattern recognition receptor signaling pathway	IDA	biological process
GO:0005737	cytoplasm	IDA	cellular component
GO:0051260	protein homooligomerization	IDA	biological process
GO:0005515	protein binding	IPI	molecular function
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0045087	innate immune response	IEA	biological process
GO:0002376	immune system process	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0005515	protein binding	IPI	molecular function
GO:0007249	I-kappaB kinase/NF-kappaB signaling	IEA	biological process
GO:0005737	cytoplasm	IEA	cellular component

KEGG pathways

Pathway id	Pathway name
hsa05131	Shigellosis

Diseases

Associated diseases	References
Teratozoospermia	MIK: 17327269

PubMed references

PMID	Condition	Mutation	Ethnicity	Population details	Infertility_type	Associated_genes
17327269	Teratozoospermia			19 (6 controls, 13 cases)	Male infertility	GSE6872 analyzed by GEO2R (cutoff 1.5 fold)